SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012996 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012996
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-26
Family SH2 domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 266-332
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-22
Family SH3-domain 0.0000871
Further Details:      
 
Domain Number 3 Region: 3-39
Classification Level Classification E-value
Superfamily SH3-domain 0.000000212
Family SH3-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012996   Gene: ENSMGAG00000012343   Transcript: ENSMGAT00000013898
Sequence length 334
Comment pep:known_by_projection chromosome:UMD2:1:51083693:51096200:1 gene:ENSMGAG00000012343 transcript:ENSMGAT00000013898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKFDFTASGEDELSFQAGDILKVLSSQEEWYKAELRSQEGYVPKNFIDFHVPPWFD
EKISRHEAESILMSKGVGSFIVRASQNSHGDFSISVRHEDDVQHFKVMRDSKGNYYLWTE
KFYSLNKLVDYYRTSTISRQKQILLRDDSREEKERRGGSLERMSRDGLHVGGAAGEAHSS
MSKRYVDHPVPVLHQQQVQGQQMWNVAEGSQISTSMEKNPSRRTLQHRDYTGSRHDRYGG
SLDRKDALHGLRYHSQGSAAAMQRRHTDPLHQQTPRILWVRALYDFDAVEHDELGFRSGD
IVEVLDSSNPSWWKGRLRGELGLFPANYVTPVLL
Download sequence
Identical sequences G1NIB5
ENSMGAP00000012996 ENSMGAP00000012996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]