SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013007 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013007
Domain Number 1 Region: 24-134
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.83e-38
Family Frizzled cysteine-rich domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013007   Gene: ENSMGAG00000012347   Transcript: ENSMGAT00000013909
Sequence length 710
Comment pep:known_by_projection chromosome:UMD2:3:80155591:80185355:1 gene:ENSMGAG00000012347 transcript:ENSMGAT00000013909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLVFFVPYSLLLTVVRGHSLFTCEPITISRCSRMPYNMTFFPNIMGHYDQDTAALQME
PFLTLMNLHCSPDVHTFLCKAFVPACLEQVHVIHPCRNLCEKVYSDCKQLIDTFGITWPE
ELECSRLVNCDESAPATAPVTTNAHGTQKTPGQTRRDFGFWCPRHLHTSNGQGYKFLGID
QCAPPCPNMYFKNYELDVAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSV
CYSIVSLIYFIGFLLGNRTACNKADDKLEIGETVVLGSQNKACTVLFMVLYFFTMAGTIW
WVILTITWFLAAGRKKWSCEAIAQKAMWFHAVAWGIPGFLTIMLLAMNKVEGDNISGVCF
VGLYDVDASLYFVLLPLCLCVFFGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIG
VFSGLYLVPLVALLGCYVYELVNRKIWETTWVFDHCDQYHIPCPYQAKALARPEIFLFLM
KYLLTLIVGISPVFWVGSKKTCSEWANFFNRNRKRDPISESRRVLQESCEFFLRHNSKVK
HKKKHYKSSSHRLKVISKSMGTSTGGTTNHGTSAVAITNHDYLSQETVAEIKTSPEASEK
EMEADGTSSQKAEEGENSGNQMLSVSKLTKEQVEKRNKADSTCDMSSLSESLKRIGEGRV
TPRNDFIESPPLQSSSSQIADVSQSGSVSLLVYSAADGRKELDSGNNSNH
Download sequence
Identical sequences G1NIC5
ENSMGAP00000013007 ENSMGAP00000013007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]