SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013109 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013109
Domain Number 1 Region: 774-883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013109   Gene: ENSMGAG00000012442   Transcript: ENSMGAT00000014011
Sequence length 912
Comment pep:novel chromosome:UMD2:5:36140085:36214297:1 gene:ENSMGAG00000012442 transcript:ENSMGAT00000014011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAMDVALSPMRTQDLDPMPSDASPMLINMTPTVDGDGEEDVMKELDSGQQYDKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSRHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHTVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEDRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGAL
DDMTSNQGKAKSFESWNYSEMDKDFPGLIRSVGLLAVATDSIAPQCNEALNEKKHLPLAS
EDGDESKDRKGLHELSQSSANSPVSKGPCSEDGISSTENKTVPAQKKPEYNLSQLSDEKI
KHPHCENSNPKRSIRDCFNYNEDSPTQPTLPKRGLFLKDDVFKDYMENNDFKRQISQIVK
NEMSRSTPSLLDPPDRSKLCLALQSTYSSPSAVSQSYDCLNKIGDSNLEYTINNHFKNSP
VSLGKPTYYTCKEKSKHKKSHDTPEKVKAGRTSVRMCKTAPPIEVKKRGHSLQNGITSHN
SQCLEGAETDSISASSDACNQGDLNGQSQGKTEPFGSPCSQKSASSASSEHINSSPLLPR
RKKNKSLSSSPCYSHTNSKDGEVWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQRPRR
EAIQNIDDWELSEMNSDSEMYPTYQVKKHKKMGRISPSSSSDVVSSLGDSIESGPLSDIL
SDEDLSMPVSGIKKYTEGKSERTAATQRIENETSASNKSALIRQLMQDIQHQENYETIWE
KIEGFVSKLDELIHWLNEAMETTENWTPPKAETDSLKLYLETHLSFKLNVDSHCALKEAV
VEEGRQLLELIVSHKSEGLKDMLQMIASQWKELQRQIKRQHSWILRALDIIKAEILATDV
SAENEEGTGSPK
Download sequence
Identical sequences G1NIK8
ENSMGAP00000013109 ENSMGAP00000013109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]