SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013119 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013119
Domain Number 1 Region: 174-371
Classification Level Classification E-value
Superfamily E set domains 2.94e-80
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000899
Further Details:      
 
Domain Number 2 Region: 64-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.53e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013119   Gene: ENSMGAG00000012458   Transcript: ENSMGAT00000014021
Sequence length 438
Comment pep:known_by_projection chromosome:UMD2:1:50475516:50478278:-1 gene:ENSMGAG00000012458 transcript:ENSMGAT00000014021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVRVNRYSIVSTEEDGHKVSALGSMNGHSRNGKGHTPRRKHRNRFVKKNGQCNVYFAN
LSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGFLFWCIAFFHGDLNAPVVGG
SPSLLKPCIMHVNSFLGAFLFSVETQTTIGYGFRCVTEECPLAIMAVVVQSIVGCVIDSF
MIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRRSHIVEAHVRAQLIKP
YMTEEGEYLPLDQRDLNVGYDVGLDRIFLVSPIIIVHEIDEESPLYGIGKEELETENFEI
VVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKNHYKVDYSRFHKTYEVAGTP
CCSARELQESKMTILPSPPPPSAFCYENELALVSQDEDEDDDEVGVALGGSTKSHLDLER
LQATLPLDTISYRRESAI
Download sequence
Identical sequences G1NIL6
ENSMGAP00000013119 ENSGALP00000019985 ENSMGAP00000013119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]