SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013255 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013255
Domain Number 1 Region: 124-445
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.59e-116
Family Leucine aminopeptidase, C-terminal domain 0.000000000218
Further Details:      
 
Domain Number 2 Region: 3-121
Classification Level Classification E-value
Superfamily Macro domain-like 4.59e-36
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013255   Gene: ENSMGAG00000012582   Transcript: ENSMGAT00000014158
Sequence length 454
Comment pep:known_by_projection chromosome:UMD2:4:59343468:59355246:-1 gene:ENSMGAG00000012582 transcript:ENSMGAT00000014158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSRCGPPLKKGKARVFHGLHQDFPSVVVVGLGKKNAGVNGQENWNEDKENIRAAVAVGC
RQIQDLEIPCVEVDPCGDAQAAAEGAVLGLHEYNELKQKKKPVVTPQLHGSAGSEAWQKG
VIYAEGQNLARYLMEAPANYITPIKFAEYIEQKLGNFASNVKVHIRPESWIATQQMGAFL
SVAKGSAEPPIFLEIHYLGGANANDSPLVFVGKGVTFDSGGISLKPSSGMDAMRADMGGA
ATVCSAIVTAAALNLPLNIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRL
LLADALCYAHNFNARAIVNAATLTGAMDVALGSAATGVFTNSSWLWNHLYEASIVTGDRV
WRMPLFEHYTKQVTDCPLADLSNIGKYSRAGGACTAAAFLKEFVTAPHWAHLDIAGVMAN
KDEVPYLRKGMAGRPTRTLVEFAARLSQDSPNPK
Download sequence
Identical sequences G1NIY2
ENSMGAP00000013255 ENSMGAP00000013255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]