SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013384 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013384
Domain Number 1 Region: 450-817
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.23e-106
Family Hect, E3 ligase catalytic domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 54-156
Classification Level Classification E-value
Superfamily E set domains 0.000000018
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013384   Gene: ENSMGAG00000012699   Transcript: ENSMGAT00000014290
Sequence length 824
Comment pep:known_by_projection chromosome:UMD2:5:39536169:39550654:-1 gene:ENSMGAG00000012699 transcript:ENSMGAT00000014290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYIIGGITVSVVAFFFTIKFLFELAARIVSFLQHEDRERRGERTIYDYVRGNYLDPRSC
KVSWDWKEPHEVGHSMAFRVHDFERRNGQSFPAHRPLGLRVHICHVELAIDIPVTQEVLQ
EPNSNVVKVAFTVRRAGRYEISIKLGGLNVAYSPYYKVFQPGMVVPSKTKIVCHFSTLVL
TCGQQHTLQIVPRDEYDNPTSNSVSLIDEHNYSLSIHELGPQEEENSDVVFEKSVVSNRQ
TCQVFFRFTLHCRGCFHACISYQNQPISNGDFDIIVLSENEKNIVERNVSTSGVSIYFEA
YLYEASNYTNTQWHLPPTHLSSSQRRPSTATEDEDEDSPSDSQTPEKVKKPKKVYCYVSP
KQFSVKEFYLKIIPWRLFTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERN
ILAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHSLLESSFKAT
RNFSVSDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTSQLFTRFSDNNQALVHP
NPGRPTYVRLKLYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFE
TDDPEFYKSKVCFILNNDVSEMDLVFAEEKYSRTGQLEKVVELVTGGAQVPVTNENKIFY
LNLLAQYRLANQVREEVDHFLKGLNELVPENLLAIFDENELELLMCGTGDISVCDFKAHA
VVVGGSWHFREKVMRWFWTVVSSFTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAP
THGTLPTAHTCFNQLCLPTYDSYEEMHKMLQLAISEGCEGFGML
Download sequence
Identical sequences G1NJ92
ENSMGAP00000013384 ENSMGAP00000013384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]