SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013467 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013467
Domain Number 1 Region: 1303-1465
Classification Level Classification E-value
Superfamily PH domain-like 8e-70
Family Pleckstrin-homology domain (PH domain) 0.00000472
Further Details:      
 
Domain Number 2 Region: 1093-1306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-52
Family DBL homology domain (DH-domain) 0.0000000961
Further Details:      
 
Domain Number 3 Region: 508-624
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-20
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 874-983
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000025
Family PDZ domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013467   Gene: ENSMGAG00000012772   Transcript: ENSMGAT00000014375
Sequence length 1706
Comment pep:known_by_projection chromosome:UMD2:2:51897838:51982950:1 gene:ENSMGAG00000012772 transcript:ENSMGAT00000014375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMGNSESQYSLQGSKNHATASTGSKQKPCSLKIRSIHAKDEKSCSLHGWGHTNSGSNYKS
RSLARSCLSHFKSSQPYSARLGDTVVKASKSNVLAKHRTHTSGDYCPGNNAVFLPDNGFH
YIGLQAGSNHAAPRECNGHILKCYGKNESLASASPSEDRRSPKVLIKTLGKLDGCLRVEF
HNSSNSKVPAEESSGPVQLLRYSPTLESKSNNLLDVRRNSSADCSSNHRLSPTDSRLRSS
KGSSLSSESSWYDSLWGNAGDINELDGPYLTRSTPDTSIHASFPPSDKKSFNQSSSLSSL
RDLYKDTNLESTPPPVIRLSDEYIDTHGSLSNRVSFASDIDVPSRVEQGSPAHYSSYTLP
CRKSKPLTEDASKKDTLKSRMRRISDWTGSLSRKKRKLQEPKCKDGGEYFDSRMDNFSTD
MLAPSQQPTLLWSPSSSHILSQRSESTNAVSSDALRQNIYENFMRELEMSRTNLENTETS
SETEDSSSESLSSLEQLDLLYEKEQGVVRKAGWLFFKPLVTLQKEKKLELVTRRKWKQYW
VTLKGCTLLFYETYGRNSMEQNSLPRYALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYL
FQATSQTDLENWVTAIHSACASLFAKKLGKEDTVRLLKNQTKSLFQKIDMDSKMKKMAEL
QLSIVSDPKNRKAIENQIQQWEQNLEKFNMDLFRMRCYLASLQGGELPNPKSLLAAASRP
SKLALGRLGIFSVSSFHALICSRDEAALRKRTLSLSQRVRNKKGLFSSLKGLDTLARKGK
EKRPSITQQVDEFLNVYCSVPDSIQKENAWETQTYVHFCDGQGVALTLKPEHRVEDVLSL
ACKMKQLEPRNYGLQLRRLVDENTEYCAPEPYEYIVDQVYDEIEICPLNVHHIHLTKTEN
ITDFGFAVTAQVDENQHLTHIFVSDVLPDGLAYKEGLRVGNEILSINGEPVSDLVLRQME
LLFSERSVMLTLRMSHCGSQQPLCASWSSDGDISRDPKSLLPPPNQSQLLEEFLDNFRKN
TANDADFDNVPDVTSSLKRSSTDGTLDQVPQREKTDPPFRSAEQISALCRNFQEVQTSSM
EGQKDNQDLPPRPLARHLSDADRLRKVIQELMDTEKSYVKDLSCLFELYLEPLQNETFLT
QDEMESLFGSLPEMLDFQKVFLETLEDGISSSSDFNTLETPSQFRKLLFSLGGSFLYYAD
HFKLYSGFCANHIKVQKVLERAKTDSAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYP
LLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVADQSGTEK
EVTELSMGELLMHSTVSWLNPFPSLGKARKDLELTVFVFKRAVILVYKENYKLKKKMPTN
ARAAHNYGDLDPFKFRWLIPLSALQVRLGNSAGTENSCIWELIHTKSELEGRPETIFQLC
SSDCENKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLIPLKNRVPATAKLASTRSLK
VLKNSPSSEWNGDQGKGTFQDSDECSLSSSTQSSSCNTTESIQEPKTSSPDQHVQSCASD
FSNALVKESDILSDDDDDDYQNLKKSSPTKDIEIQFQRLKISEEPNTDSERDQAAEKEEG
DGLKLREHPKLIRGHFCPVKRKVNSTKRNRGTLMAMQERHQSLDSHSDAANLDLNSILER
EFSVQSLTSVVNEDCFYEAVERHGKS
Download sequence
Identical sequences G1NJG0
ENSMGAP00000013467 ENSMGAP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]