SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013950 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013950
Domain Number 1 Region: 213-326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000275
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 2 Region: 636-737
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000864
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 61-188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000639
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013950   Gene: ENSMGAG00000013213   Transcript: ENSMGAT00000014870
Sequence length 873
Comment pep:known_by_projection chromosome:UMD2:5:48141390:48159719:-1 gene:ENSMGAG00000013213 transcript:ENSMGAT00000014870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQLQDEFDSSVENAEAWMKAIQERLSINDNTKGPRSALEARLRETEKIRDLEPEGTLK
MDLILAKADAALHCISEDKKHEVLSKLRHIKALWEETAIYITHCHSRIEWVWLHWSEYLK
AQDEFYIWIHNMRVTLEPDIELQLGLKEKQWQLSHAQVLLNDVLNQSVLLETLLEEASSL
FNRIGDPSVDEDAQMKMKAEYESIREEAQSRVKLLEKITEEHKKYSANINQFQSWLNGVT
ERLNCCIGETTKSSAEDRLKALKEIAKNIRNGAKKLKHLENQCADVIQNTSPLGAERLKD
ELDELRKALEKLKLLSNEEEQRLLKIQQSESAYKSQARQLEADIQEFRKGLQKLENDLDT
GEREKTEDEFVAQWRKCNATRAVLAAEESKVERLKAQLKELLRFSQDVQPHADSVISAIR
EYQSVKGKTSKMSTDAETQLSKLFQNPLESFEQWKLTVQMLLETPDPALDQIEAALAESS
QFKEKLMTLQLKKDLLTNILGEEKAKSFLEDVAEASKEREILHKNLLQRKSKLQNLILQY
KDFDAAFAPLQKKLFAIKAKLDLENEPQPNLLGKKTQLQRLQMIQDDLAELAIQMEEVEK
LVQSNATHRHEMNQLMSDIQALKRSLEIMIQQSEEHVQKHWAFNDKLSDLQQWITATTEK
IGSYQGADVMQSNESRVANLERWLAEFPDKEIQLHLVEAHGQLVMENSSPEETAHVQAEL
DQLKESWRSLKEMATGLLKRWQLNRPMADKKNIISVDSRHKSGPVFHSLDLNHKQEKTAE
GQRASSHLKLLLDFEDWLQGENTKLSKILAVNLSSTEEIKTRHKELEELQAHVPDGQRRF
EDLLRFHPVIGNSEDLEDLRYRWMLYKSKLKES
Download sequence
Identical sequences G1NKJ2
ENSMGAP00000013950 ENSMGAP00000013950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]