SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013971 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013971
Domain Number 1 Region: 443-692
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-68
Family Protein kinases, catalytic subunit 0.00000000146
Further Details:      
 
Domain Number 2 Region: 109-181
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 181-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013971   Gene: ENSMGAG00000013219   Transcript: ENSMGAT00000014891
Sequence length 762
Comment pep:known_by_projection chromosome:UMD2:1:58059088:58133546:-1 gene:ENSMGAG00000013219 transcript:ENSMGAT00000014891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNG
TDFSVSSSASTDTVASSSSSSLSVAPSSLSVYQNPTDMSRNNPKSPQKPIVRVFLPNKQR
TVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLFVSKFFEHHPISQEETTLGETTPASGSYPSVPPSDSVGPPILPSPSPSKSIPIPQPF
RPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGVRGEGAPLNQLMRCLRKYQ
SRTPSPLLHSVPSEIVFDFEPGPVFRGSTAGLSATPPASLPGSLTNVKALQKSPGPQRER
KSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLSRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWS
GSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQL
VWIRACGNLKPGCNIYKVNCKFTLKGILRNSWTGKKQNNNKKQSQILASIELLARSLPKI
HRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGGFPVH
Download sequence
Identical sequences G1NKK9
ENSMGAP00000013971 ENSMGAP00000013971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]