SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014146 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014146
Domain Number 1 Region: 15-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-80
Family Protein kinases, catalytic subunit 0.00000216
Further Details:      
 
Domain Number 2 Region: 956-1021
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 
Domain Number 3 Region: 1190-1467
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000000484
Family Tricorn protease domain 2 0.028
Further Details:      
 
Domain Number 4 Region: 1039-1156
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000516
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014146   Gene: ENSMGAG00000013377   Transcript: ENSMGAT00000015069
Sequence length 1658
Comment pep:known_by_projection chromosome:UMD2:5:51992496:52054180:-1 gene:ENSMGAG00000013377 transcript:ENSMGAT00000015069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKPFTKLVKEMQLHRDDFEIIKVIGRGAFGEVAVVKMKCTERIYAMKILNKWEMLKRAET
ACFREERNVLVNGDCQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMAR
FYIGEMVLAIHSIHELHYVHRDIKPDNVLLDMNGHIRLADFGSCLKMSEDGTVQSSVAVG
TPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEE
RFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKSHAFFEGLNWDNIRNLEAPYI
PDVSSPSDTSNFDVDDDVLRNPEVVPPSSHTGFSGLHLPFVGFTYTTDSSLSDRGTLKSA
MQSDTVTKDVDVQRDLKNTSQIEGYEKKIRKLEQEKQDLNRKLQESTQTVQSLQGPVCVT
VNTNRDKEIKKLNEEIERLKNKLTDVSKLEGQLADAVAFRQEHEDCMHKLKGLEKQCRAL
RQEKEDLHKQLVEASERLKTQSKELRDAHQQRKLAVQEFSELSERMGELRSQKQKLSRQL
RDKEEEVEMSLQKNDAMRQDIRKSEKIRKELESQLEEVMAEASKERKLREHSEVFCKQLE
NELEALKGEAGGRAAGATLEHQQELSKMKAELEKKILFYEEELVRREASHVLEVKNVKKE
VHDSESHQLALQKEIMILKDKLEKTKRERHSEMEEAVGSMKEKYERERSMLLEDNKKLTT
ENEKLCSFVDKLTAQNRQLDDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQAL
ASKMTEELESLRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALDAEIRAKQLVQEELR
KVKDANISFESKLKESEAKNRELLEEMEGLRRKLEEKYRTDPGLKLPDFQDSIFEYFNTS
PLARDLTFRTGSISEQETQGPKSEVSPSTSVVTAEQQQEEPIRLQRMPAAPSPTIQSISL
AVPKPKAHQLNIKSFTSPTQCSHCTSLMVGLVRQGYACDVCSFACHVSCKDSAPQVCPIP
PEQAKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDVPEGKSTQ
PGVVASQVLDLSRDEDFSVSSVLAPDVIHATRKDIPCIFRVTASLLGLPSKSCSLLILTE
NENEKRKWVGILEGLQSILHKNRLKNQVVHIPQEAYDSTLPLIKASLAAAIVDRDRIAIG
SEEGLYVIEVTRDVIVRAADCKKVYQIELAPKEKIIILICGRNHHVHLFPWASLDGSEGS
FDIKLAETKGCQLITTGTLKKSSATCLFVAVKRQVFCYEIHRTKPFHKKFSEIQAPGTVQ
WMAVFKDKLCVGYQSGFSLLTIQGDGQSINLVNPNDPSLMFLSQQSFDALCAVELSNEEY
LLCFSHMGVYVDSQGRRSRMQELMWPATPVACSCNSSYVTVYSEYGVDVFDVNTMEWVQT
IGLRRIRPLNMDGTLNLLNCEPPRLIYFKNKFTAGAVLSVPETSDNSKKQMLRTRSKRRF
VFKVPEEERIQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLLQSVLPA
AQDEKPCPSAANLSRQQQQQRSKTYISWPSSSGSDVGGAMPSRSMSDPDQEFDKEPDSDS
TKHSTPSNSSNPSGPPSPNSPHRNQLTLDGLDQSTCDA
Download sequence
Identical sequences G1NL00
ENSMGAP00000014146 ENSMGAP00000014146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]