SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014204 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014204
Domain Number 1 Region: 146-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-99
Family Protein kinases, catalytic subunit 0.0000000000478
Further Details:      
 
Domain Number 2 Region: 15-114
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-18
Family Pleckstrin-homology domain (PH domain) 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014204   Gene: ENSMGAG00000013444   Transcript: ENSMGAT00000015130
Sequence length 481
Comment pep:known_by_projection chromosome:UMD2:5:53762500:53796281:-1 gene:ENSMGAG00000013444 transcript:ENSMGAT00000015130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNEIGVISLIWGMGKAGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQ
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEMMD
FRSGSPSDNSGAEEMEVSMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEK
KLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVDNERRPHFPQFSYSASGT
A
Download sequence
Identical sequences G1NL48
ENSMGAP00000014205 ENSMGAP00000014204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]