SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014205 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014205
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-99
Family Protein kinases, catalytic subunit 0.0000000000478
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-24
Family Pleckstrin-homology domain (PH domain) 0.000000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014205   Gene: ENSMGAG00000013444   Transcript: ENSMGAT00000015131
Sequence length 480
Comment pep:known_by_projection chromosome:UMD2:5:53762500:53824919:-1 gene:ENSMGAG00000013444 transcript:ENSMGAT00000015131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEMMDF
RSGSPSDNSGAEEMEVSMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVDNERRPHFPQFSYSASGTA
Download sequence
Identical sequences A0A0Q3X7R9 A0A151M239 A0A1U7SR37 A0A1V4KAM6 A0A218URE3 F1NMS0 G1NL49 U3JJZ0
ENSFALP00000003094 ENSMGAP00000014205 XP_002200623.3.42559 XP_003206805.1.16129 XP_005047723.1.66865 XP_005149647.1.78019 XP_005417978.1.5688 XP_005483355.1.73095 XP_005483356.1.73095 XP_005483357.1.73095 XP_005506107.1.63277 XP_005520135.1.90289 XP_006036408.1.24877 XP_006036409.1.24877 XP_006271431.2.47583 XP_008489363.1.100939 XP_008628020.1.15636 XP_009099944.1.15306 XP_009279167.1.47732 XP_009325879.1.49731 XP_009465471.1.38621 XP_009562658.1.62272 XP_009673852.1.43253 XP_009805095.1.37116 XP_009879662.1.48241 XP_009939319.1.35112 XP_009994148.1.85724 XP_010137194.1.100080 XP_010225528.1.20684 XP_010394161.1.2935 XP_013796277.1.3284 XP_014727343.1.99236 XP_014813101.1.91963 XP_015486220.1.82291 XP_015486221.1.82291 XP_021256572.1.32913 XP_021256574.1.32913 XP_021384598.1.53032 ENSGALP00000036651 9031.ENSGALP00000036651 ENSGALP00000017402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]