SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014330 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014330
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-53
Family Phosphotyrosine-binding domain (PTB) 0.0000754
Further Details:      
 
Domain Number 2 Region: 533-591
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000024
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 732-785
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000807
Family Pointed domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014330   Gene: ENSMGAG00000013554   Transcript: ENSMGAT00000015260
Sequence length 828
Comment pep:known_by_projection chromosome:UMD2:1:64496301:64549344:-1 gene:ENSMGAG00000013554 transcript:ENSMGAT00000015260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNTPPGGYGSYSPQINGYGSPTFAQAEREQNSRTSAKALYEQRKNYARDSASSIS
ETSQYHVEHLTTFVLDRKEAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDKAVSLVDLE
SKNELENFPLSTIQHCQAVMNACNYNSILALVCKEPTQNKPDLHLFQCDEIKASFIHEDI
ESAISDSKSGKQKKRLETLRMISSADGAIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWA
AEQGDYEKQRQYPDHEETAEMIAARIDRDVQILNHILDDIEYFVTKLQKAAEAFAELSKR
KKTKKSKKKGPGEGVLTLRSKPPPPDEFVDCFQKFKHGFNLLAKLKFHIQNPSAAELVHF
LFTPLHMVVQTTGGPELASTVLSPLLTKDTIDFLQYTVTSEEGQLWMSLGDTWTKARADW
PKDQFIPPYVPRFRNGWEPPLLNFMGAPNEQELNNLAESVANFAEQQRKQEIKRLSTEPP
SVPDYPPADGYAFSNTVYKRGPLLDQGAAVAAFKQTVSRHVDRNYEAHNKTQSKKYAKCK
YEFMARNNSELSVLKEEIVEILDDRKQWWKVRNKSGNTGFVPNNILDPLRNYEGGLGLPE
PVYTRTIQKQRTDYVAKQPDPVSVTPSPPPIPAPVPAAVPLPPSTPAPIPVPVPKAPATV
SRQSSTSSDSGGSVARDSQKHKQVPVDRRKSQMEEVQDELVHRLTIGRSNAQRKFHVPRP
NIPVVNITYDSSPEDVKAWLQSKGFNPVTVNSLGVLTGAQLFSLNKEELRTVCPEGSRVY
SQITVQKSALEANSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences G1NLE0
ENSMGAP00000014330 ENSMGAP00000014330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]