SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014430 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014430
Domain Number 1 Region: 163-359
Classification Level Classification E-value
Superfamily E set domains 1.68e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000212
Further Details:      
 
Domain Number 2 Region: 49-178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.08e-21
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014430   Gene: ENSMGAG00000013654   Transcript: ENSMGAT00000015365
Sequence length 421
Comment pep:known_by_projection chromosome:UMD2:1:73390126:73394993:-1 gene:ENSMGAG00000013654 transcript:ENSMGAT00000015365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRPRKARFIAKNGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAMMWWLVAFAHGDMDPSTENTANNTKWTPCVTC
VRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMKTAQ
AHRRAETLIFSRQAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVRKTTTPEGEVIPI
HQVDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISAADLALQDLELIVILEGVVETT
GITTQARTSYIAEEILWGHRFVPIVTEEEGVYAVDYSKFGNTVKVAAPRCSARELDEKPS
ILIQTLQKSELSHQNSLRKRNSMRRNNSIRRSNSMRRTNPSLMVPKVQFITPEGSQSASE
T
Download sequence
Identical sequences G1NLM3 R4GJD4
ENSGALP00000021601 XP_003202598.1.16129 XP_004938046.1.86415 XP_015724813.1.68032 ENSGALP00000042246 ENSMGAP00000014430 ENSMGAP00000014430 9031.ENSGALP00000021601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]