SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014436 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014436
Domain Number 1 Region: 2-63,163-260
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.28e-25
Family Bacterial dinuclear zinc exopeptidases 0.021
Further Details:      
 
Domain Number 2 Region: 52-154
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.7e-24
Family Bacterial exopeptidase dimerisation domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014436   Gene: ENSMGAG00000013660   Transcript: ENSMGAT00000015371
Sequence length 298
Comment pep:known_by_projection chromosome:UMD2:2:79156812:79170642:-1 gene:ENSMGAG00000013660 transcript:ENSMGAT00000015371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTVLGTPAEEQGGGKIDLINAGAFDDLDVVFMAHPSQENAAYLPDVAEHDVTVKYFGKA
SHAAAYPWEGVNALDAAVLAYNNLSVLRQQMKPTWRVHGIIKNGGVKPNIIPSYTEMEFY
LRAPSMKDLSVLTEKVEDCFKAAALATGCKVEIKGGKNDYYNVLPNKSLQKIYKENGKKL
GIEFISEDCILNGLSGSTDFGNVTFVVPGLHPYFYIGSDALNHTEQYTEAAGSQNAQFYA
LRTAKALAMTALDVIFNPDLLEQVREDFRQMKLKEEGQVNQAETDRKPGAGVGACASR
Download sequence
Identical sequences G1NLM9
ENSMGAP00000014436 ENSMGAP00000014436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]