SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014509 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014509
Domain Number 1 Region: 565-1040
Classification Level Classification E-value
Superfamily Ras GEF 9.94e-136
Family Ras GEF 0.000000000000222
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 8.61e-52
Family TBP-associated factors, TAFs 0.000000301
Further Details:      
 
Domain Number 3 Region: 201-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-43
Family DBL homology domain (DH-domain) 0.000000106
Further Details:      
 
Domain Number 4 Region: 416-570
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-38
Family Pleckstrin-homology domain (PH domain) 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014509   Gene: ENSMGAG00000013729   Transcript: ENSMGAT00000015445
Sequence length 1330
Comment pep:known_by_projection chromosome:UMD2:5:60557681:60604749:-1 gene:ENSMGAG00000013729 transcript:ENSMGAT00000015445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPQPYEFFGEENGPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLNKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPNDI
DVVFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNNLMAKPAVALHFQSTAEGFKEAVRYVLPRLMLIPVYHCLHYFELLQQLQE
CSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGTLTKIGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSNAEYRLKEKIIMRKIQIIDKDDTSEYKHAFELVSKDENSILFAAKSAEEKSNWMAALI
SLQYRSTLDRMLDSVLLQEENEQPLRLPSPNVYRFVVEDSEDNIVFEDNLQSRNGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFISSVR
GKSMKKWVESIAKIIKRKKAQANGISHNITFESPPPPIEWHIWRVGHSEMLDLMTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKRVLDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSKRRK
VAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKTTYPLKSPGIRPNAGRHGSTSGTLRSHPLPLEKEPSKISFSRITEAEHESAVS
APTSPNTPSTPPVSASSEFSVFLDIDLNSSYGSNSIFAPVSLPQSKTFFSSWGSFPKLSD
EPQNPPPLPPRKKMDQDVSNAKGSLKSDDDPPAIPPRQPPPPKIQPRAPAYSPFEQPLHS
PPPPPPRDPLPDTPPPVPHRPPEHFINCPLNLQPPPVGRMHRDPDWFREAGPGPSSPGTP
PSTPSPRVLRRCCVIGASHNSPGHLPAPPVPPRQNSSPQLPKLPPKTYKRELSHPPLHRL
SLLENAEAPQ
Download sequence
Identical sequences G1NLU3
ENSMGAP00000014509 ENSMGAP00000014509 XP_003206888.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]