SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014616 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014616
Domain Number 1 Region: 814-1107
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.27e-86
Family Complement components 0.00001
Further Details:      
 
Domain Number 2 Region: 1186-1326
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.49e-33
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Domain Number 3 Region: 649-703
Classification Level Classification E-value
Superfamily E set domains 0.000000154
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014616   Gene: ENSMGAG00000013819   Transcript: ENSMGAT00000015553
Sequence length 1351
Comment pep:known_by_projection chromosome:UMD2:2:85138248:85193607:-1 gene:ENSMGAG00000013819 transcript:ENSMGAT00000015553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLESASGTYELLVEGHADGQRVFSNRTSLIYTAKSISVFIQTDKSTYKPGQDVMFRIVT
VYPDLKPYKASLNIYVRDPRKKLIQQWLLEEGDLGVVSKKFQLSKNPPLGDWSIDVEVNG
QVHYQSFKVIEYVLPKFDVTITTPLYYSLREKDVTGVVTAKYTYGKPVKGNVTVTCLSVS
YWTNKRNITKTMEINGSVNITCNKLMLQNLNGDQSWHHGDDDYTEPVEIIAVVTESLTGI
SQNSSTIIFPKQSDYFIEFVDYSRVIKPSLNFIATLKVTRSDSNQLTTEERQNLVTVTAQ
QSDLFFHHSSLSHFENEATEERNKTVHVLNYTVPENGIIDIEFPILSNTKTLRVQAEFLN
SKTDIGVYDVFSSPSETYLQIKTKSQEVKAGKPFELNIESNKPVREFHYLVLSKEQIMTS
GTMVAKTFNLTAENSWAPLACILVFYVDEHGAVVNDALTIPVQPALDNKVIYFVAKKMRH
DLENTSSIKSSLQMKTTILVCVQIGLRRKGNSAPLRMTQVFHELNLYNTAQYFPLVRGSF
GVFQKCSLWVSTDAILEEDKEHFLCNSRSSLERLLDDGMIPIEDGFDFSTPYVRTHFPET
WLWIDTKTRSDADTTMEVTVPDTITSWVASAFVLSENGSLGVTTVPAELEAFQPFFIFLN
LPYSVIRGEQFILEVNIFNYLKEEAEVSVILDMNDAFEIILTSTNEINATGNQQSIFVPS
EDGKTVQFPIKPKQLGEIPIKVTAISSAASDAIIQKVLVKAEGLEQTYSQTLLLDLTGGK
QQAVTKTLDFTFPSDVVSGSERVQVAAIGDLLGPSINGLSSLIKMPYGCGEQNMINFAPN
VYILQYLTKTRQLREDIQSKALSFMRKGYQRELLFQRDDGSFSAFGNEDPSGSTWLSAFV
LRCFFQARPFIDIDQDVLMDTAKWIVGHQKSNGEFQEPGKVLHSDLQGGTNNPITLTAYI
MSSLLGFQDKEHAYVIKRATNFLEDKLKEGISDNYTLALVTYALSWAKSTKAKEALSMLN
ERAEQQGEFRFWITPASEISDSWQPRSIDIELAAYALLSHFHQDRLEEGIPIMKWLSQQR
NHLGGFSSTQQDTVVALQALSLFAALTSAHKTEMDVTVTATSLENPEIFSIDTQNRFLLQ
TKEIPPVQPMTVTVSAEGRGFAVFQLNVIYNTKHTDRSLRSVQKQKAFDLNVDVKDDKDD
MNHLTLNVCTRYLGSDASPSSGMVLMEVGLLSGFSVSPDFIPLDNTVKKMEKENGKVNLY
LDTLNATQFCMDIPTVRDFKVANIQDASVSVVDYYEPRRRAVRSYNSEVMQSITPCDFCE
SDCNLCHRAGSPALLQHSSLASLFCVLFVLH
Download sequence
Identical sequences G1NM33
ENSMGAP00000014616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]