SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014702 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014702
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-74
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1700-1877
Classification Level Classification E-value
Superfamily Plakin repeat 3.79e-43
Family Plakin repeat 0.00078
Further Details:      
 
Domain Number 3 Region: 1496-1694
Classification Level Classification E-value
Superfamily Plakin repeat 3.01e-42
Family Plakin repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 6441-6600
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-28
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 218-334
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 6267-6383
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 6682-6818
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-26
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 5782-5941
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 5238-5389
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-24
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 6023-6161
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-21
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 4799-4954
Classification Level Classification E-value
Superfamily Spectrin repeat 4.94e-21
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 5675-5827
Classification Level Classification E-value
Superfamily Spectrin repeat 6.57e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 13 Region: 6813-6928
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-21
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 14 Region: 7175-7254
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 15 Region: 5391-5507
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 16 Region: 6597-6717
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 17 Region: 4467-4590
Classification Level Classification E-value
Superfamily Spectrin repeat 3.76e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 18 Region: 6877-7008,7039-7066
Classification Level Classification E-value
Superfamily Spectrin repeat 8.76e-19
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 19 Region: 4019-4145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.25e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 20 Region: 6113-6253
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-18
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 21 Region: 1200-1320,1347-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-18
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 22 Region: 5460-5614
Classification Level Classification E-value
Superfamily Spectrin repeat 7.63e-17
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 23 Region: 5012-5174
Classification Level Classification E-value
Superfamily Spectrin repeat 3.56e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 24 Region: 5140-5280
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-16
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 25 Region: 652-754
Classification Level Classification E-value
Superfamily Spectrin repeat 6.33e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 26 Region: 7086-7166
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000171
Family Polcalcin 0.044
Further Details:      
 
Domain Number 27 Region: 4689-4813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000312
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 28 Region: 3764-3886
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000125
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 29 Region: 5938-6052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000602
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 4377-4483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 31 Region: 3937-4050
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000628
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 32 Region: 4595-4701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000384
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number 33 Region: 559-651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000275
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 34 Region: 727-834,955-974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000777
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 4217-4339
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000604
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 36 Region: 4118-4227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000445
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 37 Region: 3280-3370
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000109
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014702   Gene: ENSMGAG00000013891   Transcript: ENSMGAT00000015640
Sequence length 7467
Comment pep:known_by_projection chromosome:UMD2:2:91275615:91464726:1 gene:ENSMGAG00000013891 transcript:ENSMGAT00000015640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVK
LVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWSQQTTEGYA
GIRCENFTTCWRDGRLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFFVAEKLGVARLLD
PEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGISANDVEVKWVEYQNMVNYLMQWIRH
HVTIMSDRTFPNNPVELKALYNQYLQFKETEIPPKETDKLKIKRLYKLLEVWIEFGRIKL
PQGYHPNDIEKEWGKLIIAMLEREKTLRPEVERLEMLQQIANRIQRDSRSCEDKLILARN
ALQADTKRLESGLQFQHEAEIAGYLLESENLLRQQVIDAQILIDGKYYQADQLVQRVAKL
RDELMAIRTECSSLYSKGHALTTEQTKLMISGITESLNSGFTTNLTPELSAAMTQGLTPS
LTSSSLTSGLSSGLTSRLTPAMTPAYTPGIPPRLIQSYVTGVDGGTLQTLKLMQIRKPLM
KSAFVDQNLTEEEVNMKFVQDLLNWVEEMQVQLDRVEWGSDLPSVESHLENHKNVHKAIE
EFESSLKEAKISEIQMTAPLKHSYAEKLHKLESQYSKLLNTSRNQERHLDTLHDFVSRAT
RELIWLNEKEEEEVAYDWSERNPNITRKKEYHAELMRELDQKEEVIKSVQEIAEQLLLEN
HPARLTIEAYRAAMQTQWSWILQLCHCVEQHLRENAAYFEFFSDAKEAMEYLKNLKDAIY
RKYSCDRSSSLHRLEDLVQESMEEKEQLLQYKSTVAGLVGRAKAIIQLKPRNPDCILKTS
IPIKAICDYRQIEITIYKDDECILANNSHRAKWKVISPSGNEAMVPSVCFTVPPPNKEAI
DTANRIEQQFQNVLALWHESHVNMKSVVSWHYLTNEIEAVRAGNVASIKTMLPGEHQQVL
SNLQSRFDDFVEDSQESKIFTSSDTTQLEREVSICKQYYQELLKSAERAEEHEESVYNLY
ISEVRNIRLRLETCEERLIRQIRTPMERDDLHESVFRISEQEKLKKELDRLKDDLGVITD
KCEEFFSQAAGSPSVPTLRSELSVVIQNMNQVYSMSSIYIDKLKTVNLVLKNTQGAESLV
KLYETKLCEEEAVTADKTNIENLMGTLKQWRSEVDEKREVFHALEDELQKAKMISDQMFK
MHKERDLDFDWHKEKVDQLAERWQNIHSQIENRLRDLEGINKSLKYYKDTYNSLDTWIQQ
VEDTQRKIQEIRPENSKALAKQLNQHKMLVSEIEMKQSKIDECQKYAEQYSAAVKDYELQ
TMTYRAMVDSQQKSPVKRRRMQSSSDFIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRL
EEEERSMEEEKKEHVEKAGDLLKWVSNLSKTLSKEGGEKAEKTDLPKQQISLEEMSAKKE
QIAEALQTTQAFLAKHSDKMTDEEKGEMEKQVKSLQESYSLLANEALKQLQEAHYLDDEK
MEEKVHKVIAGIIDQTTGEVHSIFQSILKGFIDYDTGVRLLENQLILTGIISPELGKCYD
LEEAKACALIDDQTLLQLQELNNAKKLISESTLSNLPVVSALEQGLISEPLAIKILENQL
SSGHLILPSTGEHLTLQNAFQRNLISPTLYAKLLERQDTCKDLIDPNCAEKISLEQMLHR
SIIHNETGLRLLPVKPQEKGRIILKCGRKITILRAAHEGLIDRETMFRLLGAQIISGGII
DPESGKQMTVEEAVSQGIIGQDTACGIFTHQVQTGGILCPNSGQRLTVDEAIQCNLISST
SALLVLEAQRGFVGLIWPDTGEIFPISTSLHQEMITSELAFKILSDRQKIAALYIPETCE
VLSLDKAAQSGLIDINSISILNSVILPDKMPSVEELESPCKNSAKWLSSYEVLSSLFHDC
EEEHEDSGTEDPACHNSDQAKKLFISYLMVNSYMDANTGGRLLLYDGQLQEAINMFLEGN
SSAYTTDVPEMAFSNKHISPKGINLKSAGDVHFSNTIGSVQGGPSGAENTSDYKNLIQFE
DLENYTCSQRKDICRSDVCSDSGTEQSQFTVEMMLSKPAELKNVESNTQNFRHRNALESL
LEDSEWTPLEVDKHNDQKANSRNTEGVFPNDSNLNLMSDTGKEEIVMTDNLSKENRNDKT
LDNSLSVNDLSDNEIWTDLEKTFTKYEPHILQPDSYRMALGNVEKDDFQGSFGSSFNMDN
EYRIPEESDSQCGDTLQFEGNGYSDQPLLDSTDVHNRPSLESCPYRHSSQSLDDSTDFQS
ELCLEDSREIQWRPLLEASTVTHDVTPEGVSDSMAQSISVEENNLVFDKLLPGDSSSDSS
LEGSDSIPQVESSCSQHECGEADSEEDSSHTLQLEDDDTPEPENVPLGFLEERGGLIVLR
EENSSYEELPTNAGENVHYIRDINQTALTASAETLETVPEEERERTRNFEEEQKLPVTMG
SGEIREGCSTSFLKRYETKTQRDRNEEDEMKAASDCYEYESEGTQEEEDYDYDYLDYDSY
DDSDSESDSEEEMDTFYSHHQCKSREDQMLIPAGDIENSEENNQNIDEYCYSLGHETEYN
LQFQSNHGNGELSLGKSETASDIYEKRCVDLTCTGKKEREQKPENDYGTFTKNENMSEDT
TEHIQSENTFDTKCISCKSEENNKTHFLDDTMISDIRVTPFLITKQATGDDENEHFIHSM
NESCSTVPILHLDHGQRQKEAVFAEEKPLNDVAGLEQLKTSSSQKDSKFLTDMHYASDGV
SSLCDQVHPITDKKHDQIRRDFETLAENGVNIKKECGVMELTKSPIHMESLGEIFDASTV
KADTEIVSNNEKVNIGQTWPDVEGGVISAEFKRDFNISSSLEQCTTSLKGENNSELDKTE
SCCLKDIEQVKNSIQNEKEFLLNIQSDNVLKDLSENKDSNGDEFTLIKAGASGSTEDAKE
SGDEIEALPSGNHTHTYTTDLSSAILSSIEADWNNVAQKESEALKNTKGEKFMASETSSF
ENGFKKQLCTESLQNKMGSSKDFQSPEMPDTLMEDLKNILQRKLKLGHTYCKEEGEPLSY
SDTKILMQNLLRMVGSTQLGSNVFNESQLKQASSTVREALMDTTLCTDTKDSDAISLLWP
DCRSPDLLRDILKQEFCNQKMSDPDEMKSQIEQEVKTPTANLMASELMKIFKMSSGDESK
RKLEELISSLLTSSQGADITIAHEGKGRVGRLCALFSTEQSEFGSEIPKEKTLADDTADA
WKSDQEHEKTDSLFRGFTGPAYTTKTLLDDNSTSKVDGEQECLKLREKMQEHLAVLQEVK
RHLENQKPISSNLEVLKEQLEQLESFESGLATFAIILKKDMKLTEEFLKFHHRDIPEEKL
KELKISYDCLQEAFLMVCDTSSKRAKQIVCSVDLEMSKLAELHQQLLSKLQTFSDWITEH
NKIMNDFRMNTNDIEDMKQNLKLLKNTAAEVARTKMQLESTAFDVQFFISEHAQDLSPNQ
SKQLLRLLNTIQKSFQEVQETVTSQVESLETELQAAQELGDQKDVAERQQECKEKLQEIC
DMLTQTENRLIGQQESLVIGDSKAELELYQTKQEEIQKDMRTSAQTLAEIVKNTENFLKE
NGGKLSQEDKAILEQKLNEAKTKCLLLSQKAEESKKELDKAMTTAIKQETEKVAAIEQLE
ESKNTIENLLDWLSNVDKEAEYGRKFKQAIEQNGTHFEEGDVKALEGEEDDVNGNLLEIQ
QDIETQVDGLVKSTEDNLNQQYQKVKAQHEKIISQQQAVIIATQSAQALLEKQGHYLSPE
EKEKMQRNMKELKAQYETALAESERKMKMTHSLREELEKFDRDYSEFETWLQQAEQELDN
LEAGASDFSGIMVKLKRQKSFSEDVISHKGDLRYITISGQRVLDAARSCSKRDGVKVDKD
GIDTSATYAEVQNKLDRASDRFKSLYTKCSILGNNLKDLADKYQHYEDASSGLLSGLQAS
EVAVNKQLSEPIAVDPKNLQRQLEETKVLQGQVSNHQIAVEKLKKAAEVLLDSRGELASD
KEEIQKTLDDIVERYDNLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMEGVEKSLEEQ
DQVPLNSAAIQDVISKSIMLEQDIAGRQSSINTMNDKVKKFMETADPSTASSLQAKMSEL
AGRFSAASKKHKEKLMKMEELKTKVELFEDLSEKLQSFLDEKNQALSETEAPRKDVSEVS
QYMQEASIELAKHKKDLEVLQNLLEELSLHALPGDKALVLEKVNALSKKFREVEETVKEK
EEDVSSCQKEIDTFELLVESLKKWIKETTERIPAAQPSLNTEELKKPLEDTLNLKDEWTL
KATELQKMNSRGTLLCNLISAVTSPAKLRAVAKSVGGTVLNGEGGAPGTQDFLKNKELTN
VQQAMSDVNHSYEDLGVSLKKKISELESMLSKMQNIQEESTSVMQWLQKMDKTASDWEAA
PTDSEAVKAQVEQHKLFETELKQSENKVQELKDKVTELLEKNPNSPEAPKWRQVLDKIDS
KWKELNQVTSERQQKLEESSNYLTQFQTAEAQLKHWLVEKELMVSVLGPLSIDPNMLNTQ
KQQVQILLKEFDTRKPQYEQLTMAGEGILKRPGEHPPSHEIVKEQLAAVAQKWDDLTGQL
SNRCDRIDQAIVKSTEYQSLLRSLSDKLSALDSKLSSSLAVSTQPNAVKQQLEIAKETKK
EIEQEMKNINAAQVLCEELSTLVGEEYLKAELTRQLDGILKSFKDIEQKSDNHVQQLQSA
YTTSHQFQQTSKDFQAWLDGKKEELKQARPVSAKLETLQSLIEEQKDFMKTLTSEISSYE
KIVAEGESILQKTQGADKAALQAQIAMLRSNWDEMDKQIKERQGKLTDCLEKALTYKQHV
ENLQPWIEKCQSNLSELKVGINPVEIENSVVQVRAWQKDLDKHHGIVEQLNNAAESLLSA
SQTDKEIIKEETKVLNEKVSMVTEQLHKKRECLENMAQRLKEFQESSRETEKQLQSAKEH
LEAHDSLGPQSFSNKHLTMMQAQQKALQALRPHVDLVRKLAQDLVVEASDSSGVSDLLLQ
AESLEQEYTDVNQQIEDRCSFLETKLQGIGHFQNSIREMFSQFAEFDDELDSMAPVGRDL
VVLQSQREDIKHFLKKLEDLIMNNENANKNCKMMLATEAEASPDLVGIKRDLEALNKQCN
KLLDRAKAREDQVEGTINRVEEFYSKLKEFSSLLGRAEEHEESQGPVGMETETINQQLNT
FKVFQKEEIEPLQVKQQEVNWLGQGLIQSAAKSTNTESLEHDLEDVNTRWKTLNKKVAQR
AAQLQEALLHCGRFQDALESLLSWLIDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLD
DRKPTVEVIKREGEKIAESAEPADKVKILKQLSLLDSRWDALLTKAEDVYRNRQLEGISV
VAQQFHEALEPLVEWLSATEKRLANAEPIGTQASKLQQQISQHKALEDDVLAHNKSLLQA
ISTGQSLKTMSSREDKDMVQEKLDSSQARYIEIQEKSNSRSELLQQAYCNAQIFGEDEVE
LMNWLNEVHDKLSKLSVQDCNTELLEKQHSELLELQEEILLRKQNVDLAIQNGLELLKQT
TGDEVIIIQDKLEGIKVRYKDITKLSSDVSKTLEQALQLAGQLHSTHEELCKWLDKVEVE
LLSYETQIPQGEELSQAQERQKELKKEAKTNKALLDTLNEVGSAFLELVPWRAREGLDKM
ITEDNERYRLVSDTISQKVDEIDAAILRSQQFDQAADAELAWIAETEKKLMSLGDIRLEQ
DQTTAQLQVQKAFTMEILRHKDTIDELVKSGDKIMNTCTEEEKQTIKKKLKSLLQKYDTV
CQMNSERNLQLERAQSLVNQFWETYEELWPWLTETEMIISQLPAPALEYETLKQQQEEHR
QLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSKIKEDVKKRALALD
EAISQCTQFHDKIDPTLESLQRIVERLRQPPSISAEVEKIKEQISENKNVSMDLEKLQPV
YETLKQRGEEMIARSEGADKDVSAKAVQDKLDQMVLIWQDIQTLTEEREAKLLDVMELAE
KFWCDHMALVATIKDTQDFIRELEGPGVDPSVVKQQQEAAEAAKEEIDGLQEELETVVSL
GSELRAACGEPDKPIVNKSIDELNSAWDALNKTWKERVDKLAEAMQAAVQYQDGLQAIFD
WVDIAGIKLASMSPVGTDLETVKQQTEELKQFKTEAYQQQIEMERLNHQAELLLKKVTQE
SDKHTVQDPLSELRLMWDSLEEKIINRQHKLEGALLALGQFQHALDELLTWLTHTEDLLN
EQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVKKAGSDLIESSAVEEASNLQSKLE
LLNQRWQNVLEKTEQRKQQLDSALIQAQGFHGEVEDMQQWLTDTERQLLASKPVGGLPET
AREQLNTHMELCAAFEAKEETYKCLMQKGQQMLARCPESAETNVEQDINNLKEKWESVQT
KLGERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLTAASRPSLILDTVLFQIDEHKFF
ATEVNSHRDQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRALDD
ARKRAKQFHEAWHKLMEWLEESEKSLDSDLEIANDPDKIKMQLAQHKEFQKSLGAKHSVY
DTTNRTGRSLKEKTTLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTD
ALQALIDWLYKIEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSAREL
IEGSRDDSSWVKVQMQELSTRWETVCALSVSKQTRLEQALRQAEEFHSVVHVLLEWLAEA
EQALRFHGVLPDDEEALRTLIDQHREFMKKLEEKKGELNKATGMGEAILAICHPDSITTI
KHWITIIRARFEEVLAWAKQHQQRLAGALAGLIANQELLEALLSWLQWAETTLTEKDKEV
IPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRKALEPTPVQSHIPVLDKGRAGR
KRSPTPGLYPSAAQAQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFAN
FDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAV
ADIFDRDGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCAKRFQVEQIG
DNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLR
SESNSSITTQPTIAKGRTNVELREKFILADGASQSMAAFRPRGRRSRPSSRGASPNRSTS
LSSQAAAPPQAIATSTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGILSTAATRVRAQFAE
TRRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISEIQSVCSDMSETVPATSRPTPRAGSR
PGSAKPSKIPTPQRRPIASKLDRSLKR
Download sequence
Identical sequences G1NMA2
ENSMGAP00000014702 ENSMGAP00000014702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]