SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014707 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014707
Domain Number 1 Region: 76-297
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-56
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 428-494
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-17
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 287-443
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014707   Gene: ENSMGAG00000013903   Transcript: ENSMGAT00000015645
Sequence length 517
Comment pep:known_by_projection chromosome:UMD2:1:78550582:78562602:-1 gene:ENSMGAG00000013903 transcript:ENSMGAT00000015645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRRHSKLINSSKLLYQEYSDVVLNKAIQSQKRVDSFAEDTESCLPSSPRLRRKVLSPQDS
YLQRLSVSSNPSLWQDIPMIRGSRMLLSMSRDEQKLQEAKFELIMSEASYLRSLNVAVDH
FQRSTELHAILSNQERQWLFSRLQDVRDVSASFLFDLEEKFEEDMFTFHVCDVALKHAPE
FRRVYLPYVTNQTYQEQTFQRLLSGNAGFQQVLERLESDPVCQRLSLKSFLILPFQRITR
LKLLLQNILKRTRPGSEEEVQATQAYDALEKLIKDCNENVQRMKSTEELIYLSQKIEFEC
KIFPLVSQSRRLVKCGELTALDFNTPSPKWKVTTRPIYLHLFNDCLLLSRPKEGGRFVVF
DHAAFSDVRGEKCEMKLHGTNKNVFRLFLLQNCQGKRVEFLFRTETHNEKLRWISALVPP
HGELDLLECPDAPQVQCIRMYKARENDELALEKADIIMVMQYSNDGWMEGVRLSDRERGW
FPSEYVELISSKHARQKNLKEEQRVKNAKHLLHRSPP
Download sequence
Identical sequences G1NMA6
ENSMGAP00000014707 ENSMGAP00000014707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]