SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014758 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014758
Domain Number 1 Region: 958-1260
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.34e-82
Family Complement components 0.0000342
Further Details:      
 
Domain Number 2 Region: 1331-1459
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.1e-32
Family Alpha-macroglobulin receptor domain 0.00011
Further Details:      
 
Domain Number 3 Region: 785-905
Classification Level Classification E-value
Superfamily E set domains 5.32e-29
Family SVA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014758   Gene: ENSMGAG00000013947   Transcript: ENSMGAT00000015698
Sequence length 1459
Comment pep:known_by_projection chromosome:UMD2:1:79614577:79639918:1 gene:ENSMGAG00000013947 transcript:ENSMGAT00000015698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKTDPESYRALRSELDSCSLLNKHSRMYLIILPAELSFPSSQRVCLDLRGVEKSIHVVLT
LVHGSGNLSLYSKIVRNNWIFECSRFQVPKPAGSEEVGTVQLRISNGQYFSAREEKQVLI
RKAGTGTLIQMEKPVYKPGQTVKFRIVTLTEDFVPVNNKFPFLQLQDPHQNRIGQWLDVR
PKQGMADLSFQLASEVSVGTYTINVLDPKVSSTFKVEEHVLQKFDVFFKGPARIYASDKT
FLLSVCGRYSYGKAVKGTVWVTLCQKAKGCPQDISKDICREYSGLVTRKGCFTSSVSTTV
FNLAPSEEDSKIYAEASLLEEGTGVQINTSSQIVISRTAASVVFETPNAYYIPGVPFKGK
IKLQDHYGNSMKNRKVNLIIKFMRRQLIKTYITDSTGRASFNLDTTAWNTSSVSLEGRFT
LENVMQKPWKTSINYINAYHHLQPFHVTTKSFLKIHPLTGKLPCGLKQSVQVTFTLSRAD
VGEDTNRIDFAYYDTGKAGIVNRGWRSVQVGKLNMLKGSFSIPLTFTADFTPSPCLVVYT
IFPSGGVTADSIRFDVALCFQNQVKVDFPTKESHTGSIVQLQLEAAPGSMCAVQAVDENV
FLMRPENELTSQKVYGLFPAIYRHGYPAQVEEHSDHCFQPQFMSSWLQGKPQYPFPPDIF
NLFWNMGLKIFSNLVIKKPTQCTQQQLLIMSARALSSQISWETSGFFSGVPSMEDQRITK
KQPQFTTQGRFPNSLPETWIWNLFFVGSNGSRSIPVMTPNAVTKWKVKMFCLSGRTFGLA
PTTSLRTVQPVFVDVTLPYSVIRGETFMLKATVFNYLQQCLQIHVVLDKLLDFQVEDCQT
CRDRECLCVEESKTFTWNVTATQLGTLNITIKTEVLDTTPRCGGRKPLPATMRRRHALIK
HLLVQPEGVLVEKSYSSLLCPRGGDMAEEPMLIHLPDNAVKGSASASVSISSDLMGLPLQ
NLDRLVQLPHGCGEQNMVLFTPIVYVIVYVLQYLEKTRQLTPVIKERATGFLHNGYQTQL
LYRHRDGSYSVFGQQDGEGNTWLTAFVAKSFGQAKKYIYIDDKNIQDALRWLEQNQLPSG
CFATKGNLFHSSLKGSLDDEISLAAYVAAALLELGQPLKGKLMQTTFHCLQRAVHNITNT
YTEAVLAYAFALAGDYEITQELLYKLEEQAIKSGGQIHWSPKTSSPASTDFWHSTQSVDI
ELTAYVLLAYLSKPQLHARDMKTAAGIVVWLTQQQNAYGGFASTQDTVVALQALAKYAAR
MFSTSGQALVKVKSQRDFGKTFQVTRQKRLLVQHAELTEIPGQFLVQVQGRSCVFAQTVL
RYHEPTPQTSIAFNLHVNTELANCSQANMHVLTVHILASYTGSRGTSNMVIMEVSLLSGF
VLARGSRMLLEHKTIIKKVEVKADVIYIYLDKLSDESQTLILQLEQIIKMKNLKPTIIKI
YDYYQPEEQALAVYSAVCS
Download sequence
Identical sequences G1NME9
ENSMGAP00000014758 ENSMGAP00000014758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]