SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014766 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014766
Domain Number 1 Region: 800-843
Classification Level Classification E-value
Superfamily E set domains 0.00000000000322
Family SVA-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014766   Gene: ENSMGAG00000013956   Transcript: ENSMGAT00000015706
Sequence length 844
Comment pep:novel chromosome:UMD2:1:79801005:79817143:1 gene:ENSMGAG00000013956 transcript:ENSMGAT00000015706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDGSSKLNIFVLLFFLLGDAAPITEPQYMVLLPFLIHTDSPEKICVQLTHLNESVTLN
AAIEYQGENRSLIDDVVSEKDLFTCIPFTIPKSRSQSTVTFITVTVKGETLQFRSRKSVL
VKNSESLVFVQTDKPIYKPGQTVLFRIVSLDENFHPLNEVLPLVYIEDPKKNRLYQWTKA
EIKEGLTQLSFNLTTEPIQGTYSVVAQKASGKTIQHPFTVEEYVLPKFEVTVKMPKVITI
LDEKLKVTVCGLYTFGKPVPGHVSFRVCRKFEYPATACYGEEAKAVCDEFSGQKTDNHGC
ISKLVKTKLFQLKRIGYENKLHVDARIEEEETGIVLTGASFSEITTTISKITFENSDSYY
KPGIPFFGQVKLVDGSGAPIANETVRISLQGGQEMNYTTNEEGRALFALNTSTLYIDSVG
IRATHKTHSYCYDHSWVNPNYEDGYLRLKRFYSPSKSFLKIEPTSETLSCGSSAEVRVHY
ILTPEAVRERKKIMFYYLVMAKGIIKQAGTRILDLDKESVSGVFILQLSVEADLAPVAQV
LVYTVTPSREVIADSTKFNIEKCFNNKVGLSFSPSEGLPSSDTHLLFRASPKSLCAVRAV
DRSVLLMKPEADLSPSLVYSLLPVKELHDYHHGTDVLLEEPLEDCVPLKKIILNGITYSP
VVEMNEDDTYSILKEMGLKVFTNSKVKKPWYCSTESHMPAQSRIIASEGLAGAPMYALRT
GELSALDSSRIHATSSTPEEVTETIRKYFPETWIWSLVSISSEGNAELDVTIPDTITEWK
ASAFCMSPDTGFGLSPTVSLRAFQPFFVELTLPYSVVRGEAFTLKATVFNYLTACIRVSV
LLQS
Download sequence
Identical sequences G1NMF6
ENSMGAP00000014766 ENSMGAP00000014766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]