SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014797 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014797
Domain Number 1 Region: 965-1265
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.67e-86
Family Complement components 0.0000318
Further Details:      
 
Domain Number 2 Region: 1337-1467
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-37
Family Alpha-macroglobulin receptor domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 796-914
Classification Level Classification E-value
Superfamily E set domains 5.18e-23
Family SVA-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014797   Gene: ENSMGAG00000013976   Transcript: ENSMGAT00000015737
Sequence length 1473
Comment pep:novel chromosome:UMD2:1:79964255:80004441:-1 gene:ENSMGAG00000013976 transcript:ENSMGAT00000015737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFLGREMISFFCLTVRKMCLKFLLAILLLHATAGQEPELQYVLMVPAVLQSDSPSQVC
LQFFNLNQTVSVRVVLEYDTINTTIFEKNTTANNGLQCLNFTIPPVISVPLAFISFTAKG
TTFDLKERRSVMIWNMESFVFVQTDKPIYKPGQSVMFRVVALDFNFKPVQEMIYFFSPQD
PQSNRIFQWQNVTSEINIVQIEFPLAEEPILGNYKIIVTKKSGERTNHSFLVEEYVLPKF
DVTFTAPGSLTVMDSELTVKICAVYTYGQPVEGKVQLSVCRDFDSYGRCKKSPVCQSFTK
DLDTDGCLSQVLSSKVFELNRIGYKRNLDMKATVTEKGTGLQLTATQSISITQVMSSLQF
ENVDHLYRRGIPYFGQIKLVDKDNSPISTKVIQLFVNNKNIHNFTTDVNGIAPFSIDTSK
MFDPELSLKAIYKTSDQCHSEGWIEPSYPDASLSVQRLYSWTSSFVRIDPLWKDMSCGQK
RMITVYYILNTDGYENISIVNFYYVGMAKGKIVLTGEIKVNIQADQNGTFMIPLVVSEKM
APALRLLVYMLHPAKELVADSVRFPIEKCFKNKVQLQFSQKEMLTTSNVSLVIEAAANSF
CAVRAVDKSVLLLKTETELSAETIYNLHPIQDLQGYIFNGFELEDDPQDPCISPDNIFHK
GLYYRPLTSGLGPDVYQFLRDMGMKFFTNSRIRQPVVCTSGTVRPPSYFLNSGFTASTHH
VKLSAEVAREERVKRHILETIREFFPETWIWNIVLINSTGKASVSYTIPDTVTEWKASAF
CVEESAGFGISVPATLTAFQPFFVDLTLPYSIIHGEDFLLRANVFNYLNHCIKINVLLSE
SPDYQTKLISPEDDGCVCTKKRKSYVWNISPKGIGEVFFSITAETNNDEACEEEALRNIS
IDYRDTQIRALLVEPEGIRREETQNSLICMKDDVITQDVVIDLPTNVVEGSPRVSFSVVG
DIMGTAMQNMHQLLLMPFGNGEQNMVLFAPNIYVLDYLNKTRQLSEDVKSKTIGYLVSGY
QKQLSYKHPDGSYSTFGVRDKEGNTWLTAFVYKSFAEASRFIFIDDNVQAQTLMWLARKQ
KTDGCFQTAGILVNSALKGGVDNELSLSAYITIALLEAGHSLSYTVIRNAFYCLETVSEK
NISDIYTQALVTYAFCLAGKAEICESFLRELQKSAKEVDGSKYWEQKQRSPPEKSHLLDH
VPSNEVEITSYVLLALLYKPNHNQEDLTKASAIVQWIVRQQNPYGGFSSTQDTVVALQAL
AAYGEATYNSVTQNAIKITSKNTFEKVFTVNNENRLLLQQTPLPEVPGKYNLTVTGTGCV
LIQPVLRYNIYLPEGAFGFSLSVQTSNASCPQDQPGKFDIVLISSYTGKRSSSNMVVIDV
KMLSGFVPVKSSLDKLIDAHTVMQVEYKKNHVLLYLENILQKKKKEVTFSVEQDFVVTHP
KPAPVQIYDYYVTEEYAVAQYTSLCRDVVADMG
Download sequence
Identical sequences G1NMI3
ENSMGAP00000014797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]