SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014802 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014802
Domain Number 1 Region: 504-655
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.11e-68
Family Ankyrin repeat 0.0000000696
Further Details:      
 
Domain Number 2 Region: 2-228,265-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.64e-62
Family BAR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 382-500
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.000000974
Further Details:      
 
Domain Number 4 Region: 263-371
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 829-856,910-968
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-18
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014802   Gene: ENSMGAG00000013988   Transcript: ENSMGAT00000015742
Sequence length 970
Comment pep:known_by_projection chromosome:UMD2:2:100977820:101039620:1 gene:ENSMGAG00000013988 transcript:ENSMGAT00000015742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALDVDRTVLYKMKKSVKAINVSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGTAFLKFS
VFTKELTALFKNLIQNMNNIITFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKVTKIEK
EKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIK
YFHAQCNFFQDGLKAVESLKPSIETLSTDLYTIKQAQDEERRQLTQLRDILKSALQVDQK
EKSRRDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTIS
HGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWTSVLQNSKEE
ALNNAFKGDDNTGENNIVQELTKEIISEVQRMTGNDVCCDCGAQDPTWLSTNLGILTCIE
CSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPLDEMVKPNPSSD
MNARKDYITAKYIERKYARKKHADSAAKLHALCEAVKSRDIFGLVQVYADGVDLTEKIPL
ANGHEQDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTCKGSTALHYCCLTDNVECLK
LLLRGKASIEIANESGETPLDIAKRLKHTHCEELLTQALSGRFNSHVHVEYEWRLLHEDL
DESDDDVDEKLQQPSPNRREDRPVSFYQLGSNQLQPNVASLARDAANIAKDKQRGFMPSI
LQNETYGAILSGSPPPIQPSVPVTSSAPPLPPRNIGKVLGSGIQTISSSNTMWKTNSLGV
ESISRQRSSSDPPAIHPPVPPLRVTSTNVLSPAPPPPVAKTASIMEALNQQSKQQPAPPQ
TKPTPPPLPPQPPSRVSQRKPIPGSEKPSGLSNKGQSRGLGALQQTANTLAQIQPPAPMP
RKSQISKTKPKRVKAIYNCVADNPDELTFSEGDIIVVDGEEDQEWWIGHIDGDPSRKGAF
PVSFVHFIVD
Download sequence
Identical sequences G1NMI8
ENSMGAP00000014802 ENSMGAP00000014802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]