SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014827 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014827
Domain Number 1 Region: 42-371
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-85
Family Protein kinases, catalytic subunit 0.00000283
Further Details:      
 
Domain Number 2 Region: 932-1000
Classification Level Classification E-value
Superfamily G protein-binding domain 1.02e-25
Family RhoA-binding domain 0.0000821
Further Details:      
 
Domain Number 3 Region: 1164-1253,1330-1364
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000386
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1272-1321
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 389-500
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000068
Family Myosin rod fragments 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014827   Gene: ENSMGAG00000014017   Transcript: ENSMGAT00000015767
Sequence length 1401
Comment pep:known_by_projection chromosome:UMD2:2:102080252:102131458:-1 gene:ENSMGAG00000014017 transcript:ENSMGAT00000015767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLNSLVLDLDYPALRKNKNIDNFLNRYEKIVEKIRALQMKAEDYDVVKVIGRGAFGEVQ
LVRHKMTQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYM
VMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGH
LKLADFGTCMKMDETGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEM
LVGDTPFYADSLVGTYSKIMDHKNSLHFPDDVEISKHAKNLICAFLTDRDVRLGRNGVEE
IKHHPFFKSDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQ
LPFIGFTYYRDNLLLSDSSQSCRENESVQSSKNEEDSKEFQKKLSKLEEQLSNELQAKDE
LEQKYRSANTRLEKIVKELDEEITSRKNVESAVRQLEREKALLQHKNTEYQRKAEHEADK
KRNLENEVNSLKDQLEDLKKRNQNSQISNEKINQLQRQLDEANSLLRSESETASRLRKNQ
TESTKQIQQLEANNRELQDKNCLLENAKLKLEKDFLNLQSALESERRDRSHGSEIISDLQ
GRISSLEEEVKNGKSALAKLEMEKRQLQEKLTDLEKEKSNMEIDMTYKFKVMQQNLEQEE
AEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERALKQKVENRLLEAEKQRSMLD
CDLKQSQQKINELLRQKDKLNEDVKNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEK
QLKQENNHLQEIKLSLEKQNNELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKE
ECEEKTKLSKEMQQKIQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIM
KELEIKEMMARHKQELTEKDATIASLEEANRTLTSDVANLANEKEELNNKLKEEQEQIAK
LKEEEANIGNIKAQFEKQLLNERTLKTQAVNKLAEIMNRKGPVKRGADTDVRRKEKENRK
LHMELKSEREKLTQMMIKYQKEINEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQS
LHIGLDNSSIGSGPGDAEADDGFPVHITQSHTMESMSFTYKHSSTSVSIATKPSSSRMLL
DSDSDSEEEPMSCSHSPTEVDSTESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYD
SEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPV
EPMGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMD
KKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTS
MKVQPNQSIRRPSRQLPPNKP
Download sequence
Identical sequences G1NML1
ENSMGAP00000014827 ENSMGAP00000014827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]