SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014886 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014886
Domain Number 1 Region: 5-194,290-379
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.13e-44
Family Pancreatic carboxypeptidases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014886   Gene: ENSMGAG00000014071   Transcript: ENSMGAT00000015827
Sequence length 517
Comment pep:known_by_projection chromosome:UMD2:2:109953611:109958169:-1 gene:ENSMGAG00000014071 transcript:ENSMGAT00000015827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGTTTYFAFCYPFSYTECQEMLAQLDSRFEECRHMAPSSPLDSVYYHRELLCHSLDKLRV
DLLTVTSCHGMQERREPRLDKLFPDTATPRPRCFTGKRVFFLSSRVHPGETPSSFVFNGF
LHFILREEDPRAQMLRRMFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLNPDAELHPA
VYGAKAVLLYHHVHSRVLPGSPDWRTYVSPLSTSVLSTRSSNHSVPEAALSELEKTNNFR
NASSTWSRGLSPSQEPQVDLIFPERRCEEEAGQPLPLPEAILPQHSGLAYYVDLHGHASK
RGCFMYGNNFSDENDQVENMLFPKLISLNSPHFDFTGCNFSEKNMYAKDKRDGQSKEGSG
RVAIYKALGIIHSYTLECNYNTGRSVNSIPLACHDNGRASPPPPPSFPSKYTVELFEQVG
RALAVAALDMAECNPWPRIVLSEHNCLSNLRAWMLKHVRGTRGNGACVRRRGGRSPPRAL
GSGLPASASESALSRVRSFSHGSQQDSPRVRASPSFP
Download sequence
Identical sequences G1NMR0
ENSMGAP00000014886 ENSMGAP00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]