SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014996 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014996
Domain Number 1 Region: 756-983
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-59
Family DBL homology domain (DH-domain) 0.00000000446
Further Details:      
 
Domain Number 2 Region: 351-529
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.22e-55
Family Regulator of G-protein signaling, RGS 0.0000000998
Further Details:      
 
Domain Number 3 Region: 987-1120
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-41
Family Pleckstrin-homology domain (PH domain) 0.000000739
Further Details:      
 
Domain Number 4 Region: 27-123
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-21
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014996   Gene: ENSMGAG00000014176   Transcript: ENSMGAT00000015940
Sequence length 1481
Comment pep:known_by_projection chromosome:UMD2:2:111303708:111317915:-1 gene:ENSMGAG00000014176 transcript:ENSMGAT00000015940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSARPRSPCRLSSLSSLGDSSSERRSPGHRRQPSDSSETTGLVQRCVIIQKDQHGFGFTV
SGDRIVLVQSVRPGGAAMKAGVQEGDRIVKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SPPPSVGLSNSQQDMSMTGAPRNAPACPPPPPPPPLPPPQRITGPKPLQDPEVQKHATQI
LRNMLRQEEAELQRFYEAYNRNPGTVVGEQIEGARRRVSQLQLKIRQETSGSVDLGRLCG
DSSMAMFRAAEGRLSLDSQDGDSGLESGTERFPSVSEISLNRNSVLSDHGLDSPRTSPVI
TARLFQHHRRQGSDTTFIPTTEQGSERTGRPLIIGPEEDYDPGYFNNECDSLFQDLGKLK
SRPAHLGVFLRYIFSQADPSPLLFYLCADVCQQTTAKDSRGLGKDIWNIFLDRNAPLRVK
VSEQLLAEIEARLRNGDDVRAALFEAQEMVMPEIQEQIQDYRTKRTMGLGSLYGENDLLD
LDGDPQKERQVAEKQLAQLGDILSKYEEDRSSPMAFALSTYMNHTGIRSREPRVASTSEK
AQALPDKDKWLPFFPKTKKSSSTKKDKDAMEDKKRNPILKYIAKPKMSQSTFHVPLSPVE
AVKPGNVRNIIQHFENNQHYESQEPGSQRLSTGSFPEDLLEGDGSRAEVKLGRSESLKGR
EEMKKSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPYTPKMGRR
SIESPSLGFGADPFLPHLLEDEQGQLSDLEPELDSQNWQHTVGRELLASLPQKEIDRQEV
INELFATEGSHLRILRVLDLLFYQRMRKESLLSREELALLFPNLPDVIEIHNSLSESMKK
LREEGPIIKEIGDLMLSRFDGLAKEEIQQVTADFCSYQSIALELIKTKQRKETRFQIFMQ
EAESNPQCRRLQLKDLIISEMQRLTKYPLLLENILKHTEAGTSEHDKLCRARDQCRDILK
YVNEAVKQAENRHRLEGYQKRLDATSLERTSNPLAAEFKSLDLTSRRMIHEGPLTWRISK
DKTVDLHVLLLEDLLVLLQKQDEKLVLKCHGKTALGSLDNKQTFSPVLKLNSVLIRSVAT
DKRAFFIICTSELGPQIYELVALTSSEKNTWMEVLEEAVQSAMRNATFPPKRQMPEPTRM
APSSTAIVQSNPSPSCSLVLQDPDVSPILSQVSSSAAEVEESSSVLSYPSIPGLGHNPEL
SPLPAADDNPTELLGREQPPVLLEEPESSEVEEEELPAGSLHTEVSDALPEPSMRLADDL
TPTPSVIGGTHTWDSVLSSQDSASQEVLAEPPSAAEEPKPRLGWEEQSERGPTVSAEEQS
SLKVVRKGCTAPAEGAQEATPSPGSSQSETELQEGGGANVDGNYFYVSMPTGPPESAPPP
GPPQAIQPEEPPRPNTAECPPDPPGPLHDVDLIFRTIEQLTLKLNRLKAVEAAHRELLRS
LGHSSSADTTPVGLPAPGMEGWSQRPHSPEADSPLTRSLRS
Download sequence
Identical sequences G1NN02
ENSMGAP00000014996 ENSMGAP00000014996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]