SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014999 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014999
Domain Number 1 Region: 27-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.92e-40
Family Frizzled cysteine-rich domain 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014999   Gene: ENSMGAG00000014180   Transcript: ENSMGAT00000015943
Sequence length 665
Comment pep:known_by_projection chromosome:UMD2:2:111538541:111624074:1 gene:ENSMGAG00000014180 transcript:ENSMGAT00000015943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSWMFCCFWLLDVLVGCTRGHSLFSCEPIILRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLECSRDFRPFLCALYAPVCMEYGRVTLPCRRLCQRAYSECSKLMEMFGVS
WPEDMECTRFPDCDEPYPRLVDLSLGGEPTEEAPMAVQRDYGFWCPRELKIDPDLGYSFL
RVRDCSPPCPNMYFRREELSFARYFIGVISIVCLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIVLLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSVLYLVPLLVVIGCYFYEQAYRGVWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALVVGIPSVFWVGSKTCFEWASFFHGRRKKEVVNESRQVLQEPDFAQSLLRDPN
TPIIRKSRGTSTQGTSTHASSTQLAMLDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPCS
YRGIEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSSNPLTHITHGTSMNRVIEE
DGTSA
Download sequence
Identical sequences G1NN05
ENSMGAP00000014999 ENSMGAP00000014999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]