SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015063 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015063
Domain Number 1 Region: 2216-2271,2313-2448
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000918
Family Galacturonase 0.019
Further Details:      
 
Domain Number 2 Region: 2987-3173
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000024
Family Galacturonase 0.044
Further Details:      
 
Domain Number 3 Region: 1192-1255
Classification Level Classification E-value
Superfamily E set domains 0.00000000303
Family E-set domains of sugar-utilizing enzymes 0.071
Further Details:      
 
Domain Number 4 Region: 1012-1099
Classification Level Classification E-value
Superfamily E set domains 0.00000000331
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 5 Region: 255-309
Classification Level Classification E-value
Superfamily E set domains 0.0000000293
Family E-set domains of sugar-utilizing enzymes 0.058
Further Details:      
 
Domain Number 6 Region: 1378-1469
Classification Level Classification E-value
Superfamily E set domains 0.000000204
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 
Domain Number 7 Region: 1480-1554
Classification Level Classification E-value
Superfamily E set domains 0.00000021
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 8 Region: 349-406,433-453
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000000314
Family Anthrax protective antigen 0.02
Further Details:      
 
Domain Number 9 Region: 923-999
Classification Level Classification E-value
Superfamily E set domains 0.00000105
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Domain Number 10 Region: 1567-1639
Classification Level Classification E-value
Superfamily E set domains 0.00000395
Family E-set domains of sugar-utilizing enzymes 0.083
Further Details:      
 
Domain Number 11 Region: 1102-1181
Classification Level Classification E-value
Superfamily E set domains 0.00000801
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 
Domain Number 12 Region: 1734-1793
Classification Level Classification E-value
Superfamily E set domains 0.000056
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015063   Gene: ENSMGAG00000014240   Transcript: ENSMGAT00000016011
Sequence length 3881
Comment pep:known_by_projection chromosome:UMD2:2:113494681:113725359:1 gene:ENSMGAG00000014240 transcript:ENSMGAT00000016011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLWRPSFLVFFAVTSEGLLIEPQEGSVAGGTWITITLDDSASHELEHLSPASWPHLEVS
LVNADLPMLPCDVSPVYFDLSTIRCRTRRPLRSSPQEGLYYVEVSFKGRVINNLTGVEKE
NYAFKFSAEQTPVVYQISPPSGIPGNLIEIYGKTFAGRYETLDFNVDYIDGPAVLVAEGD
GWTSLCSFADGQAGSIYSIQTKEGLGTMQCRVEGNHIGSHNVSFSVFNKGKSVIDKDAWL
ISAKQELFLYQTHSEIASVFPVAGSLAGGTDLTITGDFFEEPVQVTAAGVPCKVKRVSPR
QIICTTEAVGRSRMLGASQPGNRGLLFEVWDDASDLTEAGPGYRWQFVPNAQSPVRFLSA
AKQSFSSRLRGFFVAPQTNNYTFWIQADGPASLYLSSSQDPQHKVRIASLPSGNLEWSGK
WVKNWSESWQPKSQKFELTAGLRYYLEALHHGKAPSNGMRVGVQIHNTWLNPQVVNNYYT
ERHEIRAHALYLPDVQMLTVSGTGWFSISWSNAPRRMIHTNSTALQVQTAIEELLSVGCD
IEPTSAKILFHDGFEKEGSNVTKHVVYGTEPFCGRFSARSPSQLVKATPSSLLRYDLTEY
THVCFAHKGHMSNILHISVSYTNISLSSMERNLTCQWDFNGTDPTSWTFSCTDLWTGCVS
RSVPLQDLPINTPVFVHQIDLLSIQQKETAGLFYLDEVIITDRAVTVSQRDPKPRRLGGQ
IIEAVTVVGSSPTYNVSWLVSGCGASLSLLSLRGAVLCEGSEEDDHLYVSTEDRLQVSSP
PLGGTFCIHLGSTVISDVSVHISSHQLRRLLQTNTDSSTAPYFNTSDFIVTKDSETCYES
IWTLTWRTKAGDLPNVINVSAENLTGLKPAVSSRVVYDGGVFIGPIFGDMLATSNNKTQV
VVVVNDVPASCSGSCSFQFSQEMTPLVSDVEYSADDRFQATVVIRGVGFSEESTTLQVQV
KNKTCNIIMSDQTKVVCKMERLPLGVHQLALLVRPYGFALNASTGEGIFLRVEPRLVAIE
PPRASEIGGLRVALKGTGLEGVNLVLFGSQPCPVLEDTRSSTQIECKVPSRGAEDAAVHV
TLVSGYQSTTVTNLFQYDPSLNPAIVSLSRNRSGLAGGRELQIGISSFASYRGSDIKVQI
GGVWAQIQVQMDNGLNVTLPGLAVGWYNVSVIINGVAIASNRVEPLIHYISEVFSIEPCC
GSFLGGTLLTISGLGFSQNRSLVSVSINEQTCLVTHLAEETIWCLTPPAANFSNEVSQDV
PVRVNILVSNSSLQNVPVAKSITFNYQRALTPLVTTVDVEILESSMLLSIQGVNITGSVA
KLGDSECELELQRGNESAMFYECSLPLSNLEPGIYPIQVIQRQLGYSHVTARLQTITVTP
RITSIFPSDGSICGGMLLTISGIALRSRRDLEQVSLDGNYSCELQSSDDNTIKCVVLSET
HLLPYRWWAEVSWALNVTVTVNGISSVCPGDCTLHLREQSTPLVDVVTWETNGMYTDVTI
KGQRLAWPGDSPVVHVNDQAVCKVTFWNETSIRCQMGCIAPGEHNISISNRRSGQACFRS
TSSVLTVTPQVHQFYPQNFSTNGGGLLTFAGAALKGKSRTSVLIGQQPCLILNVTCIAIQ
CTVPPGNGARALRLTVDAISYDIGEISYSEESTPTFLSFAVTGLLLTINVSQVMETDAIH
VFVGDSACRGVTITHSELQCSPPLLPAGEYPVLGLHVPRGWASSNLTFISQLMVTAVRCN
WGGLNGGVVHLHGTGFSPAQTSVTICGSPCEMLGNATTTSLSCLAPRLQASLAFLCSLTH
SSANCQEDRSTIIKCDVQVMVGSYCQQGPRSYLYLCGESQAFLFAPAHWCVFLIDDTPFN
LPSRFSPKVERDEVLIYNSSCNITMETEAEMECEGANQPITAKITEIWKNWGQNTQENSH
TLFCFTKRRKKNFFKSPLAQDKDNHTCENGQFFLLNFNVNTANYLLSSSGGKLVFTGPGP
VELHAHYILISDGGELRVGSSTARFHHRAHIYLYGSLHSPPLFPYGAKFLAVRNGTLSIH
GWMPKVTFTYLKSSALANDLRLVLQKPVDWEPGDEIVVGRTGLGDAQQQEEVAIIESINN
TELYLRSPLRYSHSVGEERVNGQSLPLTAVVALLSRRVVVQGNVTKERISHVRECAEAGS
TRGGSRCLYGRSERQLGSRDLGAVVIVEAFQGATSQLQVEGVQFHHMGQAFWQRRSALTV
AGNTQMADSYIRGCCLLDSFGQGLRLTGISNLSVDSNVFFNISGHGLLLVFTCSVSFYFI
EYKCKHNLKRSGLEKGNRIRNNIVIGLSATDGLSNIETLSPAGIYIRAPANHIEGNTVCA
AGYGYFFHLSPEGPSKMPLLSFSENTAHSCTRHGLLVYPEYLPDSPNSPVQFNSFTVWSS
QGGVQIFSSSNLKLQNFRIYACMDFGIDIIESLGNTTVANSVLIGRIGQEDKTCMSAGLK
TPKRFQLFVSNTAFRNFDMSTCTAIRTCSGCYQGQGGFTVRLEHLTFTNSPFQVSFPFPH
AAILEDLDGSVTGKEGSHILPYTDILVASCTTSANFSQALGGCVCSKDLVFHRMSLHLRE
APEIPYNLTVIDSRNKTTTVNYVPDTLSNLHGWMCLLLDKETYTLTFDSPLVSKQLQYSV
TFSNFTTGNYLLVEHKDLPAQLEVVVSCGKRTGQPLQSLPSYGHHRNCDWYLDSTLRKLT
YLVTGADLIHLELKEKERAPSPTSDPSDSVLKWSHPETWKDVEKGWGGFNCSIPGPGEDV
IILPNRTILVDTDLPPLRGLYILGTLEFPTNSSNVLSAACIVVVGGTLNVGSFQHPLERD
SKLLILLRASEGIYCDHLEEINVHPGSIGVYGKMQMYSSYPGKSWTHLGASVAPGNERIL
LEDEVDWRPEGDIVISSSSYEAHQAELVTLKEVSGHSITLHERLLHRHIGHPHDIEDGRR
IPLSAEVGLLTRNIQIKSDVPCTGKILVGHFTDSSGREFEGVLQLLNTEFLNFGPPQLSA
IEFRNVTQQSSVVSSTIHGSCGVGIKAVMSNGIWLHDNIVFNTVGPGIDLEGKNHSLIRN
LVILSRQPESLLNWVAGIKVNLVIGVSLYGNVVAGSERIGFHIKGQECLLDVDYCSENVA
HSNLHGIHLYRGDGFQTCTRITGFLSYKNYDYGMMFHLGSSVIIDNVVLVDNTVGLLPVI
HCLYAKQCYTGKRHIELRNSTIVATSSTFDCIRDRIKPQAADLTSRDRPPHYLQRGRAGI
LWPKFTTVTSQRPDNPWHKIVLCPKVLGLMKLKDVTFTGFTKSCHSEDRDVCIMSDTDHL
GIMPLITAERSRMLHVNEKDKFYFHAASVQTSEDTTFPEKSCEGSRKVLIKDLDGNLLDL
EPPVSVIPKSEFEWTRFYLQSGIYRDDSKCIFKPSVQGYFCKQADYAFVILENLDTSTVK
QELFPIAAVTGSFMDTFSDGASDASCRSAQHPSAFFSVLPTTKLTTVCFPGLTPLIFRLY
LLSGQNSTKLPLAIFYNEPLSLRVFTEGKYISPTPSSFSWNVGAGTNYFSFEDNLLYVLL
HEEEPVEIITGLSLHVAFTVTETTGEEGEANIMHRLADFLQVGHDQVRIVYRVPGGESML
KVISDNASKKKYHCPNMTFCTAFHSRSGSQKQGRGAVNARVVQLSDAAGPSKVLIFEFGD
PPGHQINEFQRSLTIDNLKILASAIINAHQTGDLQTVLGLPVDSIMVTSSRSVLSVHVKQ
NGSRQHLGTCLYVRPYSISVHVQPSDGEIEKQLPVQPQIVFLDKKGRRVDTVGPPSEPWV
ISAHLKGSSEAVLRGLTEVQVIGGCASFSNLAVSSSGTNWNLVFTVTSPPGAKFTVLSQP
FTIFPVPAGEKASLILVVLMSAIASAFVVTLVLCWFKKSKN
Download sequence
Identical sequences G1NN62
ENSMGAP00000015063 ENSMGAP00000015063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]