SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015074 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015074
Domain Number 1 Region: 234-335
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 24-84
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000794
Family B-box zinc-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015074   Gene: ENSMGAG00000014253   Transcript: ENSMGAT00000016022
Sequence length 419
Comment pep:known_by_projection chromosome:UMD2:1:83048105:83052733:1 gene:ENSMGAG00000014253 transcript:ENSMGAT00000016022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQKKTASHVVMELESTRDCSQAGKPFFCPSHPSEELWLFCEQCDQPVCQDCIAERHQQH
SYDFTSNAVHQHRDSLRKLLRSTQEHMSTLEDVLGRTDGVGSAIRARAEAVATEISLFAR
GYVKAIEEHRDRLLKQLEDLKVQKENLLHLQKAQLQQLLLDMRTGVEFTERLLTSGSDLG
ILVTKGVVASRLAKLNSAAYSTHPREDDNIQFSPQERAGQCQGYEVFGAVICKAVDPAKC
TLHGEDLWSTHQNELTGFTLLCNDTTGEQMGRGGEAVMVTITHKDKKDCAVKPTVCDNGD
GTYHISYSPEEPGLYAVCVYVKGQHVQGSPFIVMVKSKFRKHQGMFHCCTFCSSGGQKAA
RCACGGTMPGGFQGCGHGHKGHPGCPHWSCCGQVKMSSECLSGLPSDRSQRSLLRTVEL
Download sequence
Identical sequences G1NN71
ENSMGAP00000015074 ENSMGAP00000015074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]