SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015088 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015088
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.46e-42
Family RUNT domain 0.00000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015088   Gene: ENSMGAG00000014267   Transcript: ENSMGAT00000016036
Sequence length 359
Comment pep:known_by_projection chromosome:UMD2:2:115353536:115437305:1 gene:ENSMGAG00000014267 transcript:ENSMGAT00000016036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLT
ITVLTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFPERLSDLGRIPHPSMRVG
VPTQSPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTP
LSSTRGTGLPAITDVPRRLSGASELGPFSDPRQFTSISSLTESRFSNPRMHYPATFTYTP
PVTSGMSLGMSATTHYHTYLPPPYPGSSQNQSGPFQTSSTPYLYYGTSSGSYQFPMVPGG
DRSPSRMLPPCTTTSNGSTLLNPNLPNQSDGVEADGSHSSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences G1NN85
ENSMGAP00000015088 ENSMGAP00000015088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]