SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015205 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015205
Domain Number 1 Region: 133-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.53e-47
Family Amylase, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 65-164
Classification Level Classification E-value
Superfamily E set domains 0.0000000000308
Family E-set domains of sugar-utilizing enzymes 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015205   Gene: ENSMGAG00000014371   Transcript: ENSMGAT00000016154
Sequence length 326
Comment pep:novel chromosome:UMD2:1:87831803:87859282:1 gene:ENSMGAG00000014371 transcript:ENSMGAT00000016154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCIVDFSVFRVCLLKLVVIDVPAYAVLPMMPLLSINKIDEKVRYALFYKRLKSIDDNEG
GLNKFSKSYKSFGVNQFVDGGVYCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMDYGKWEL
FIPPGQDGFSPVPHGSKLKVVIRAQNGELLYRISPWARYVVRYEGKVNYDWVHWDPPQSY
IRKHRSPKKLKSLRIYESHVGIASPEGKIASYKNFTFNVLPRIRDLGYNCIQLMAVMEHA
YYASFGYQVTSFFAASSRYGTPDDLKELIDVAHSMGITVLLDVVHSHASKNSEDGLNKFD
GTDSCFFHSGPRGTHRIWDSRLFDYA
Download sequence
Identical sequences G1NNI0
ENSMGAP00000015205 ENSMGAP00000015205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]