SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015213 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015213
Domain Number 1 Region: 118-189
Classification Level Classification E-value
Superfamily E set domains 0.0000000088
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000015213
Domain Number - Region: 451-554
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.032
Family Acetylhydrolase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015213   Gene: ENSMGAG00000014378   Transcript: ENSMGAT00000016162
Sequence length 561
Comment pep:known_by_projection chromosome:UMD2:1:89493732:89506769:1 gene:ENSMGAG00000014378 transcript:ENSMGAT00000016162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRDSFRLQIFCLLMAVLAVVVLVHNFFQLEHLDDYTVSGSNWITENNDQPSLSQTTKTT
RKPYCGYEQQTLSKRERAEQESLLAALQWPKPPDGKIAFLQSTDPVHSDFVIVKPSRFFK
VGDQLEVVVRMRDFQGKPKQYGGDYLQARIHSPLLKAGAIGRTVDCRNGLYKVFFTLLWP
GEVKVSVTLVHPSEAVQVLLRLREEKPDRVYFKSSFKSGRFSETTECNVCLPGDLPVCNF
TDLYTGEPWFCYKPRKLSCSSRISHAKGGYQKGLLTHEESLFFQSDVNIKMPILSNGPDS
VIVKPKAFADSSNMDRAEDPTVSPSGYYYEDLWRPRTHWIYHFNKSDDISKCLQGKVIHL
FGDSTIRQWFEYLTAAVPDLVEFNLGSPKNVGPFMSVDLKHNVLLKFRCHGPPIRFTTVF
TSELRYIANELNGIVGGRNTVIAITIWSHFSTFPVEVYIRRLRNIRRAVIQLLDRSPKTL
IVIRTANVQELGPEVSLFNSDWYSLQLDSVMRKMFSGIAVHFVDAWEMSLAHYLPHNLHP
KEVIVRNQIDTFLSYVCPLQF
Download sequence
Identical sequences G1NNI7
ENSMGAP00000015213 XP_010718759.1.16129 XP_019474901.1.16129 ENSMGAP00000015213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]