SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015330 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015330
Domain Number 1 Region: 5-71
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000507
Family Fibronectin type III 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015330   Gene: ENSMGAG00000014487   Transcript: ENSMGAT00000016285
Sequence length 226
Comment pep:novel chromosome:UMD2:1:106202114:106241279:-1 gene:ENSMGAG00000014487 transcript:ENSMGAT00000016285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGSRDHIILEHLQWTMGYEVQITAANR
LGFSEPTLYEFSMPPKPNIITDTLFNGLGLRAVIGLGVAALLLILVVTDVSCFFVRQCGL
LMCITRRICGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERITSHEDGSPVNEP
NETTPLTEPEKLPLKEENGKEALNPETIEIKVANDIIQSKEDDSKA
Download sequence
Identical sequences G1NNT1
ENSMGAP00000015330 ENSMGAP00000015330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]