SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015339 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015339
Domain Number 1 Region: 274-356
Classification Level Classification E-value
Superfamily DEATH domain 1.93e-16
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015339   Gene: ENSMGAG00000014489   Transcript: ENSMGAT00000016294
Sequence length 358
Comment pep:novel chromosome:UMD2:1:106740472:106742516:1 gene:ENSMGAG00000014489 transcript:ENSMGAT00000016294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRAHFPRAGFFRCAETELKFLVRTATTVEYEYSFWERHLPDGIPAGWMEAGPVFDIRAML
GAVEAIHLPHFLCLTEGNVNTSEMRIGHVVNGNLLLEKPDAVKPFHAELRDPSFSPMGVI
LLSAAFPFIPVHSLVLLYRVIRAADITLHLYLIPNNHGLEKVVDKDEKRRGHSLLVNKPP
QTKRPLNFNTWYRVSGPSQAEINPQELKFVYLTSDSRQLHTEIYNKDLQEGMQLSLMKVA
QEGEKECDPLWAAFLRAGDIEPPAASSPPSYSAGLHFVEQHREQLIQRVTSVSTVLDRLY
GHVLSNEQYQRIRAMPTMQEQMRLLYSFTPSWDVTCKDLFLDALKDTNSHLIQDLQGQ
Download sequence
Identical sequences G1NNT4
ENSMGAP00000015339 ENSMGAP00000015339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]