SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015410 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015410
Domain Number 1 Region: 180-376
Classification Level Classification E-value
Superfamily E set domains 2.8e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000445
Further Details:      
 
Domain Number 2 Region: 71-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.37e-22
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015410   Gene: ENSMGAG00000014552   Transcript: ENSMGAT00000016366
Sequence length 425
Comment pep:known_by_projection chromosome:UMD2:1:112933892:112978548:-1 gene:ENSMGAG00000014552 transcript:ENSMGAT00000016366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLVCLLLMAANVLEEDSMEQDIESPVTIHQPKLPKQAREDLPKNLNKECAKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYMR
GDMDHIGDSTWTPCVSNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIVLLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTNAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTKEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYVTSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETNTPVYSAKELAEMASRAELPLTWSVSSKLDQHAELETEEEEKNQEDQNERNGDVANLE
NESKV
Download sequence
Identical sequences G1NNY9
ENSMGAP00000015410 ENSMGAP00000015410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]