SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015476 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015476
Domain Number 1 Region: 15-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-73
Family Protein kinases, catalytic subunit 0.00000666
Further Details:      
 
Domain Number 2 Region: 730-917
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.22e-50
Family Nucleotide and nucleoside kinases 0.0000000389
Further Details:      
 
Domain Number 3 Region: 600-720
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-32
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 465-563
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 333-384
Classification Level Classification E-value
Superfamily L27 domain 1.77e-19
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 394-445
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000453
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015476   Gene: ENSMGAG00000014607   Transcript: ENSMGAT00000016432
Sequence length 921
Comment pep:known_by_projection chromosome:UMD2:1:117799551:117936197:1 gene:ENSMGAG00000014607 transcript:ENSMGAT00000016432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWIIYCCFFCVCVCFRGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREAS
ICHMLKHPHIIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMR
QILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTP
HFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWS
HISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRK
LKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLD
FLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELK
RILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVR
LVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTV
EQLQKMLREMRGSITFKIVPSYRTQSSSCEFSFPAHLHKQTVADGNFYDNNIIGDLPSTT
QPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGT
AGLIPSPELQEWYDLCFLLKRTNVLNLSAQALCTWFGKKKKQYKDKYLAKHNAVFDQLDL
VTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENG
KNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVL
RTAEFAPFVVFIAAPTITPGINEDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRH
LEEAIELVCTASQWVPVSWVY
Download sequence
Identical sequences G1NP41
ENSMGAP00000015476 ENSMGAP00000015476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]