SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015505 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015505
Domain Number 1 Region: 781-904
Classification Level Classification E-value
Superfamily EF-hand 3.12e-53
Family EF-hand modules in multidomain proteins 0.000000603
Further Details:      
 
Domain Number 2 Region: 906-1015
Classification Level Classification E-value
Superfamily EF-hand 2.18e-34
Family EF-hand modules in multidomain proteins 0.00000342
Further Details:      
 
Domain Number 3 Region: 996-1083
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 447-573
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-20
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 597-736
Classification Level Classification E-value
Superfamily Spectrin repeat 9.79e-18
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 6 Region: 333-460
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 743-780
Classification Level Classification E-value
Superfamily WW domain 0.0000000000163
Family WW domain 0.00014
Further Details:      
 
Domain Number 8 Region: 166-275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000504
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 8-114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000401
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015505   Gene: ENSMGAG00000014636   Transcript: ENSMGAT00000016462
Sequence length 1399
Comment pep:novel chromosome:UMD2:1:122360962:122734496:1 gene:ENSMGAG00000014636 transcript:ENSMGAT00000016462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFFQVSRDLPEKQKEIEILLKDFIDLDQQINQLTLWVTPVKNQLELYNQVGQPGAFDIKE
TEAAVRAKQPNVEEVLSKGCHLYKEKPATHPVKKKLEDLNADWKAINLLILQLKEKPTFG
EPALSSPGVLTSGQTVAVDTQTRVTKETTSSTPEMPSSVVLEVPALADFNKAWAELTDWL
SRLDREIKAQRVTVGDLDDINDMIIKQKAILQDLEQRRPQLDELITAAQNLKNKTSNQEA
RTIITDRNKIKQIENLPEELQLHLAXRIQQLHEMLKDSTQWLEAKQEAEQVLEQAKAKLE
SWKEISYTVEALKKQNTELKQFSKEIRQWQMNIEIVNDVALKLLRDYSADDTRKVELMTD
NINATWATINKRVSEREAALESALLMLQEFYLDLEKFLAWLTEAETTANVLQDATRKEKT
LEDPQMVRELMKQWQDLQAEIDAHTDIFHNLDENGQKILRSLEGSEDAVLLQRRLDNMNF
RWSELRKKSLNIRSHLEASTDQWKRLHLSLQELLAWLQLKEDELKQQAPIGGDLPTVQKQ
NDAHRTFKRELKTKEPVIMSALETVRLFLADQPVEGLEKVYPEPRELSPEERAQNVTKVL
RRQADDVRTEWDKLNLRSADWQKKIDDALERLQGLQEAMDELDLKLRQAEAFKGSWQPVG
DLLIDSLQDHLEKVKVYRAEMVPLKEKVHQVNELAHRFAPPDIQLSPYTLSCLEDLNTRW
KVLQVAIDERIRQLHEAHRDFGPTSQHFLTTSVQGPWERAISPNKVPYYINHETQTTCWD
HPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLNLSAACDALDQHNLKQNDQP
MDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVV
SLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVR
SCFQFANNKPEIEAAPEIEAALFLDWMRLEPQSMVWLXQSMVWLPVLHRVAAAETAKHQA
KCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRD
FAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHDDTHSRIEHYASRL
AEMENTNGSYLNDSISPNESIDDEHLLIQHYCQSLNQESPLSQPRSPAQILISLESEERG
ELERILADLEEENRNLQAEYDRLKQQHDHKGLSPLPSPPEMMPVSPQSPRDAELIAEAKL
LRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQADAKVNGTTLSSPSTSLQRSDSS
QPMLLRVVGSQTSETMGEDDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADD
LGRAMETLVTVMTDDKVLE
Download sequence
Identical sequences G1NP66
ENSMGAP00000015505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]