SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015566 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015566
Domain Number 1 Region: 409-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-77
Family Protein kinases, catalytic subunit 0.0000000344
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-45
Family Pleckstrin-homology domain (PH domain) 0.0000306
Further Details:      
 
Domain Number 3 Region: 293-439
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-30
Family SH2 domain 0.0000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015566   Gene: ENSMGAG00000014692   Transcript: ENSMGAT00000016524
Sequence length 677
Comment pep:known_by_projection chromosome:UMD2:1:129751794:129778187:-1 gene:ENSMGAG00000014692 transcript:ENSMGAT00000016524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKIILEELLLKKSQQKRKMSPANYKKRLFVLTKTSLSYYEYGKEKRGRKKGSIDIEKI
RCVETVNLEESTPPARQYPFQIVYKDGLLYVYAPDEERRNKWLAALHREIKENTNLLSKY
HKRFFTNGRFLCCNQTCKTAPGCTTWEKCYTEVHPEILQKTSTNPTYPQNRQPKAWIMLN
KGLQAKSSLPLNYDISPISKYISVPKSKMPFCLCLDSCKLTLKSGFSPNNKYHVLQEEDF
AWWKVRDLEGMARCYDIVSIKCMSKCVNHTRSEKNLEKENSSVSEQTAEEQSMAQHDWYA
AGISRAQSEQLLHQKGKEGAFVVRKSSQAGIYTVSVLSKFHESKKGIVKHYHVHKTPENK
YYLTENHCFETIPKLIYHHQHNSAGMVPRLRHVVSTQINKVPATASLGNGIWELKREEIV
PLRELGSGQFGAVHLGKWKGQYDVAVKMIKGGVMSEDEFIAEAQTMMKLNHPKLVRLYGV
CSKLYPIYLVMEYMPNGSLLSYLQIHGKELQPLQLLEICYDVCDAMAFLESCQLIHRNLA
ARNCLVDSNLTVKLSDFGMTRYILDDLYVSSLGTKFPVKWSAPEVFHYTKFSSKSDVWAF
GILMWEVFTLGKQPYELYDNMQVIEKVSQGYRLYRPQLVSDITYQIMYNCWHELPEKRPA
FHQLLSFFEVLREDSRP
Download sequence
Identical sequences G1NPB9
ENSMGAP00000015566 ENSMGAP00000015566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]