SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015746 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015746
Domain Number 1 Region: 597-786
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.0000000152
Further Details:      
 
Domain Number 2 Region: 790-931
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-38
Family Pleckstrin-homology domain (PH domain) 0.000000174
Further Details:      
 
Domain Number 3 Region: 297-426
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000518
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 4 Region: 1032-1086
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000321
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 464-553
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0000314
Family C-terminal domain of PLC-beta 0.0083
Further Details:      
 
Domain Number 6 Region: 39-197
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000471
Family CRAL/TRIO domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015746   Gene: ENSMGAG00000014856   Transcript: ENSMGAT00000016706
Sequence length 1133
Comment pep:known_by_projection chromosome:UMD2:1:144800636:144861963:-1 gene:ENSMGAG00000014856 transcript:ENSMGAT00000016706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSRKLSVCMQSLWLLSVTLNSSTDEIMHQDIIPLYAADIHDQLKKQFAYLSGGRGGDGC
PVITFPDYPAFSEIPEKEFQNVLTYLTSIPRLSLRDAGIGFILVIDRRQDKWTSVKASIL
RIAASFPGNLQLVLVLRPTGLFHRALSDIAFKFNKDEFKMKVPIIMLGSVSELQGYIDKT
QLTEDLGGTLDYCHNRWLSRRTAIEGFAQKVKQTAQILQSFGTELAETELPNDVQSTSSL
LAVHTEKKDKMKEDIRLAVEQGDDILGSITKPVTENPEYKLNQDQLDNQTTVESLRLLAQ
LHETESAFDEFWIKHQQKLEQCLHLRNFEQNFREVKAALDIVSERLSAFTDVGNSCSHVE
HILKDLVNFEEKSRETVAKARMLASEGDAFIQSNHYAVDSIIPKCSELHHLCDAFTTEME
RKRNVLNKSLELHGLLEKSMKWCDEGIYLLASQPVDKCQSQDGAESALQEIEKFLDTGAG
NKIKELKKVYREYAHILNEDLKEHIQKVFQKQESMEEMFQKRQISLKKLAAKQTRPVQPV
APRPEAFVKSPCTSPGLQRDCVSNTESGVLRKVNYRRGKSEMSELHQSRGGSTMDDEENL
AVLRQHVMNELIETERAYVEELLCVLEGYAAEMDNPLMAHLISPELQNKKDILFGNMEEI
YHFHNRIFLRELENYVEYPELVGRCFLDQMEDFQIYEKYCQNKPRSESLWRQFSDSVFFQ
ECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKNCEGAEDLQEALNSILGILKAV
NDSMHQIAITGYDGNLNELGKLLMQGSFNVWTDHKKGHSKVKDLARFKPMQRHLFLHEKA
VLFCKKREENGEGYEKAPSYSYKHSLNMAAVGITENVKGDAKKFEIWYNAREEVYIIQAP
TPEVKATWVNEIRKVLTSQLQACREASQHRTLEHTQSLPLPASSLNSPSRNNIRNMKKMD
ERKADLTGLEGYVTTVASKYPEKGKGWAKTSHSLDASEENDGWSSAEEPLNSSDAEEEGG
GGGGGSEMKLTPGKYTVVTDYEKGVSEEFAVKGGDLVQLIREGEDGLWYVKNLTTGREGW
IPANNLLMLIGNSKSAQSLSSSESGTASSTLSTSSSCSDSCNASSTSFSDIKG
Download sequence
Identical sequences G1NPS3
ENSMGAP00000015746 ENSMGAP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]