SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015760 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015760
Domain Number 1 Region: 176-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-50
Family DBL homology domain (DH-domain) 0.00000000749
Further Details:      
 
Domain Number 2 Region: 368-492
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-34
Family Pleckstrin-homology domain (PH domain) 0.0000157
Further Details:      
 
Domain Number 3 Region: 100-172
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-25
Family SH3-domain 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015760   Gene: ENSMGAG00000014868   Transcript: ENSMGAT00000016720
Sequence length 797
Comment pep:known_by_projection chromosome:UMD2:8:9137063:9202438:-1 gene:ENSMGAG00000014868 transcript:ENSMGAT00000016720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CESCFHEILDKCFHYLSFQTFDANDLYQGQNFSKVLSSLVALNKVTADIGLGSDSVCARP
SSHRIKSFDSLGSQSLHSRTSKLFQGQYRSLDMTDNSNHQLVVRAKFNFQQTNEDELSFS
KGDIIHVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSNEKPVSPKSGTLKSPPKGFDTSA
INKSYYNVVLQNILETENEYSKELQTMLSNYLRPLQASEKLNSTNTSYLMGNLEEISSFQ
QMLVQSLEECTKLPEAQQRVGGCFLNLMSQMKSLYLAYCANHPSAVNVLTEHSEELGEFM
EVKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRPDIQKSMTAFKNLSA
QCQEVRKRKELELQILTEAIRCWEGEDIKTLGNVIYMSQVMIQCAGSEEKNERYLLLFPN
ILLMLSASPRMSGFIYQVRLPMTGMTITKLEDTENHKNAFEISGTMIERILVSCNNQQDL
HEWVDHLQKQTKVTTVGNPAIKPHSVPSHTLPSHPVTPSSKHSDSKQIPLTPAYHTLPHP
SHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPK
RKPERKPSDEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLA
DDDQSSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRSRKESAPQVLLPEE
EKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLV
RKVLKNMNDPSWDETNL
Download sequence
Identical sequences G1NPT5
ENSMGAP00000015760 ENSMGAP00000015760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]