SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015770 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015770
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily E set domains 0.000000203
Family Filamin repeat (rod domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015770   Gene: ENSMGAG00000014879   Transcript: ENSMGAT00000016731
Sequence length 445
Comment pep:known_by_projection chromosome:UMD2:1:148645438:148658925:1 gene:ENSMGAG00000014879 transcript:ENSMGAT00000016731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNGEKFTSSPGENAFQVKITAPDEQFTRVGVQVLDRKDGSFIVRYRMYASYKSLRIEVKI
KDKHVAKSPYILKGPVYHENCDCPQEESNVWLEEMNCPQVFPQIQRDLANFPVVDPDKIA
IEIPQRFGQRQSLCHYTIKDNEVYIKTYGEHVGFRIFMDAILLSLTRKVKMPDVEFFVNL
GDWPLEKKKPPQNLHPIFSWCGSSESKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGP
SWEDKNTTAFWRGRDSRKERLELVKLSRKYPEIIDAAFTNFFFFKHDENLYGPIVKHISF
FDFFKYKYQINIDGTVAAYRLPYLLAGNSVVLKQDSIYYEHFYNELQPWKHYIPFKSDLS
DLLEKLQWAKEHDEEAKKIAKSGQEFARNNLMGDHIFCYYFKLFQEYSSLQVSEPKIRDG
MEKVQQPEDDLFPCTCHRKKTKDEL
Download sequence
Identical sequences G1NPU4
ENSMGAP00000015770 ENSMGAP00000015770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]