SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015830 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015830
Domain Number 1 Region: 88-273,481-620
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.4e-59
Family Regulator of chromosome condensation RCC1 0.011
Further Details:      
 
Domain Number 2 Region: 3234-3424
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.65e-26
Family APC10-like 0.01
Further Details:      
 
Domain Number 3 Region: 1821-1864,1948-1990
Classification Level Classification E-value
Superfamily E set domains 0.0000000034
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 4 Region: 3973-4035
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000131
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015830   Gene: ENSMGAG00000014935   Transcript: ENSMGAT00000016793
Sequence length 4230
Comment pep:novel chromosome:UMD2:1:118368926:118686037:-1 gene:ENSMGAG00000014935 transcript:ENSMGAT00000016793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSFTDCHTEGQNILFTDGEYVNQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKCLH
ACGISLFDLEKDLHIISTGFDEESAVLGAGREFALMKTASGKIYYTGKYQSLGIKQGGPS
AGKWVELPITKSPKIIQFSVGHDGSHALLVADDGSIFFTGSASKGEDGESTKSRRQSKPY
KPKKIIKMEGKIVISTACNNGSSSVISKDGELYMFGKDAIYSDSTSLVTDLKGHFVTQVA
MGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGSMSQGGKGFGVENMATAMDEDLEEELDEK
DEKSMMCPPGMHKWKLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCAV
CGCCKACARELDGQEARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQRVN
RRHRLEEGRGPLVFPGPIFMNHREQALARIRPHPAQLKPKRDKHKDGSGERGEKDASKIT
TYPPGAVRFDCELRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQ
ALPGPSTQVTAGSNHTAILLMDGQVFTFGSFSKGQLGRPILDMPYWNAKPAPMPNIGSKY
GRKATWIGASGDQTFLRIDEALINSHVLATSEIFASRHIIGLVPASMSEPPPFKCLLINK
VDGSCKTFNDSEQEDLQGSGVCLDPVYDVIWRFRPNARELWSYNAVVADSRLPSAPDMQS
RCSILSPELALPTCSKALTTRSHAALHILGCLDTLAAMQDLKMGIANTEEETQAVMKVYS
KEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFELGP
DGGDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSH
GQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPTSDGSASKGKQQTSEPVHIL
KRSFARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGTCCL
RLLRVYTCEIYPISATAKAVVEETSKLADCIGKTRTLLRKILSEGVDHCMIKLDNDPQGY
LSQPLSLLEAVLQECHNTFTACFHSFYPTPSLQWACLCDLLNCLDQDIQEANFKTSSSRL
LAAVMSALCHTSVKLTSIFPIAYDGEALLRSVVKQVSTENDSALAHRFPLLVSHMEKLSQ
SEENVSGMTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASA
LGSEVDGLNSLHSVKSTPNRFTKTSQGRSWNTGNGSPDAICFSVDKAGIVVVGFSVYGGG
GIHEYELEVLVDDSDHTGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENV
KYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRSEY
DGDLQSQLLNKANEEDKNCSRALSVVSAVVRAAKDLLHRALAVDADDIPELLSSSSLFSM
LLPLIIAYIGPVAAAIPKVAVEVFGLVQQLLPSVAVLNQKYAPPAFNPNQSTDSTTGNQP
EQGLSACTTSNHYAVVESEHPYKPACVTHYKVTFPECVRWITIEFDTQCGTAQSEDVLRL
LIPVRIAQSLGFGPKHASVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDY
VKDEKACFYGFKCYAIGYEFSPGSDEGIIQLEKELANLGGSCAAALMKKDLALPIAGNEF
EEDLEILEEAALQVCKSHSGILGKGLALSHSPTILEALEGSLPLQVQSNEQSFLEDFIAC
VPGSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTVITVQTKDQYGDVVHVPNMKV
EVKAIPVSQKKTSLQQEQVKKVQRIPGSPAAAASPSTDMTFGGLPSPKLDSSYEPMIVKE
ARYIAITMMKAYENYSFEELRFASPTPKRPRPSENMLIRVNNDGTYCANWTPGAVGLYTI
HVTIDGIEIDAGLEVKVKDPPKGMIPPGTQLIKPKAEPQPNKVRKFVAKDSAGLRIRSHP
SLQSEQIGIVKVNGSITFIDEIHNDDGVWLRLNDETIKKYVPNMNGYTEAWCLSFNQHLG
KSLLVPVDESKSSTGDFFKDLNSHCPQEAVMQEQDMSLLRGGPGVYKVVKTGPSGHNIRS
CPNLRGIPIGMLVLGNKVKAVGEVTNSEGTWVQMDKNSMVEFCESDEGEAWSLARDRGGN
QYLRHEDEQVLLDQNVQTPPPSPFSMQAFSKGTSCSNGQGFDYGLGNNKGDRVNFTGAAR
PISPAGKSDMSSKHRADSRSPKLDVRMNRAAADQKKPRNTDGLTASESLLLKSDAAKLRS
DSHSRSLSPNHNTLQTLKTDGRTTTGLRAESPGPGTRSSSPKTKTLTAVRSGASSPRSSS
PHDKTVPQKASSQTKLDPPRERSKSDSYTLDPDTLRKKKVPLTESLRGRSTSPKPKIITK
DLTPTETENRAPSPHVVQENLHSEVVEVCTSSTLKTNSITDSTCEDNTEFRSLDDSSSKV
HFSIGKAPLKDEQDMRASPKVSRKCAGRHTRPKKEKSNFLFKGDSSKSIEPAKQAMSPSV
AECARAVFAAFLWHEGIVHDAMACSSFLKFNPELSKEHAPIRSSLSQQPAEEKETKLKNR
HSLEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKIETTSFETSSH
HTVKSKSPLPLTLQHLVAFWEDISLATIKAASQNMIFPSPGSCAVLKKKENDKDNKKTKK
EKKKKEKVEARPRGNLFGEMAQLAVGGPEKDTICELCGESHPYPVTYHMRQAHPGCGRYA
GGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREKYLREKQAAAREKIKQSRRKPM
QVKTPRALPTMEAHQVIKANALYLLSLSSAAEPSILCYHPAKAFQSQLPSLKEGISEDFP
IKMPCLYLQTLARHHHENFAGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPE
SNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVKAPRRRVNSGDA
EVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAFVIQHHDLEGLEIAMKQALRKSA
CRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKSNKENAEQEKD
TRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGSALQQMALRCWSLKFKQS
DHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEVMNQELCIVVCLKDLTSIVDI
KTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVCVHVDNSRDLGNK
VTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDNHIIKIELKGPENTLRVRQVK
ILGWKDGESIKIAGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKA
LLSSPEGEEKVHNATSDADLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEW
EHAISSKENANSQPNDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLH
TASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKLGILDM
FLGCIAKALTVQLKAKGTTITGTAGTTAGKGVTTVTLPMIFNSSYIRRGESHWWMKGSTP
TQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIALTKMEEEYRSPVRCIATTRLWLA
LASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACGNLCTDCDRF
LHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREQTGKP
TTSSSEACRFCGCRSGTELSAVGSVCSDTDCQEYAKIACSKTHPCGHPCGGVKNEEHCLP
CLHGCDKNATTLKQDADDMCMICFTEALSAAPAIQLDCSHVFHLQCCQRVLENRWLGPRI
TFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFY
NDPAGYAMNRYAYYVCYKCKKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCP
KHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLE
GTECPLHVVHPPTGEEFALGCGVLQKCSHF
Download sequence
Identical sequences G1NPY8
ENSMGAP00000015830 ENSMGAP00000015830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]