SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015876 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015876
Domain Number 1 Region: 270-403,709-884
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily PH domain-like 9.97e-30
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 1089-1156
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7e-20
Family SAM (sterile alpha motif) domain 0.004
Further Details:      
 
Domain Number 4 Region: 170-239
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.87e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000366
Further Details:      
 
Domain Number 5 Region: 110-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015876   Gene: ENSMGAG00000014975   Transcript: ENSMGAT00000016840
Sequence length 1163
Comment pep:known_by_projection chromosome:UMD2:1:174813207:174885946:1 gene:ENSMGAG00000014975 transcript:ENSMGAT00000016840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSIKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAESSTKNV
NNSFTIITPFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDG
IAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKAMVHTACKDLYPRKCPLGQC
KVSIIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQSLNPAQV
FDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLSLHKQCQLGVLPLGTGND
LARVLGWGGSCDDDTQLPQILEKLERASTKMLDRWSIMSYELKLPAKPSIPSVTVEEDFQ
ISAYEDSVAAHLAKILNSDQHSVVISSAKILCETVKDFVAKIGKTYEKPVENADEADAMA
IKCSELNEKLDLLLQALHTEAQAAPILPGVTPPIVEEEGEEFSSEESLSESKEQLVECVA
KSSTQKLFKPREQLMLRANSLKKAVRQIIEQAEKAVVDEQNAHSEEQVNQSPVEYSKELD
ESKEEEKEEDTKEFESQTSKTAPRSPDRRTSRGVHSQTGSFSAPALAASKENLPVLNTRI
ICPAGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDPDSLEGYSEKCVMNNYFGIG
LDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKVQLECDGQYIP
LPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFGAPSFDDKILEVVAVFGSMQMAVSRVIKL
QHHRIAQCRSVKITILGDEGVPVQVDGEAWIQPPGVIKIVHKNRAQMLTRDRAFENTLKS
WEDKQKYDSCKSVIRSPLYPQQAVELATEEEVTQVQLCSQAAEELITRICEAAKIHGLLE
QELAHAVNACSHALNKANPRFPESLTRNTAMEIAVNVKALHNETESLLVGRVPLQLEAPH
EELLSDALHNVEIELRKLAEIPWLYYVFQPNDDEDPPLDYAKRNNRSTVFRIVPKFKKEK
VQKHKTSPQPVQKWGTDEVAAWLDLLSLGEYKEIFISHDIRGSELLHLERRDLKDLGITK
VGHMKRILQGIKELSKNTPSSEV
Download sequence
Identical sequences G1NQ24
ENSMGAP00000015876 ENSMGAP00000015876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]