SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015953 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015953
Domain Number 1 Region: 879-1173
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.71e-88
Family Complement components 0.00000133
Further Details:      
 
Domain Number 2 Region: 1432-1577
Classification Level Classification E-value
Superfamily TIMP-like 1.69e-37
Family Netrin-like domain (NTR/C345C module) 0.0015
Further Details:      
 
Domain Number 3 Region: 1286-1433
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.31e-31
Family Alpha-macroglobulin receptor domain 0.0022
Further Details:      
 
Domain Number 4 Region: 564-632
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 8.89e-19
Family Anaphylotoxins (complement system) 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015953   Gene: ENSMGAG00000015046   Transcript: ENSMGAT00000016919
Sequence length 1584
Comment pep:novel chromosome:UMD2:1:170729683:170788822:1 gene:ENSMGAG00000015046 transcript:ENSMGAT00000016919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HILLVTESRELHKEAVQKIRILLSSKKGYIFIQTDKPIYTPNSKVRYRIFILDNAMRPSE
DTVTVAVLNSKGMVVMKSEWKIKAAFSENFEIPDIAEPGTWKIKAWFQQYEMSNASAEFE
VKKYELPSFEVKLIPLQPYYSIWNENFVFDIEAKRHSYGKGIEGIAYVRFGIIDETENKV
FLPGLEQQLSIQSGKGRVTLTTPLLEEKLKKSISTLEGFHLYVAVTAVETASGEMREEEL
SNVKFVKSPYVVDLSNTKKYFVPGAPFSVVASVTLVDGSPAASLPVTATVTMPGKSSMKK
TALSNNDGLIPLTFDIPADAQTLQVVVKAEEGKERLESPETSIRAERYQSATRNYLSISI
PHTVLAPGDTLRVTLNAIHQSGSGKIDYFYYMVIAKGQAELLGRVSSSNKVINLKITQKM
VPAFRFLAYYFIANQGRQEIVADSVWVDVMDVCEGKIKVRTEHEIYEPTNNIKLQIETDH
AGTVALAVVDKAVFILNKKNKLTSKKVFKAMNSYDLGCSAGGGADSAQVFTDVGLAFLSD
TIQSNVREGYTCLQATRREKRSLDFRKKILEIASKYQDADLRKCCEDGMKLNAMKYSCLK
RLTRVTGPPKCREAFKACCESAVALRKEEAAKRRTAVSLARNYDMEEEMFEEMTLNLRSY
FPESWLWQFKEVKSPGNHSVASIAPDSITTWEVQAISISPQKGFCVADPHTFDVFKDFFV
SLRLPYSVKRHEQLEIKAVIYNYLPNDLQVTVKMDAVKGLCTAEATGKAVQLKLEAKGNS
ATPAYFSVVPLIVGEIPITISALDSNTGHSDSVRKNLKVVAEGVLQREEQSLDVEPYLFT
VRSHTLDFSRPSDMIPGSESHMFVSLKGNPMGDSVENCLSLNGTEKLIQVPTGCAEQTMV
KMAPTVYAIEYLDASEQWKNFDPERKDEAIKMIEKGYTRLLEFQKDDGSYGAFKSTPSSV
WLTAFIVKVLTRCKEYISVEDSHIRNSVLYLLNQQQADGSFHDHHPVMDRKMQGGIESAG
EDLALTAFVTIALQQTLQVYKESSDVAQAVRRSVVYMNNELPGNTDCYSTVVAAYALTLV
QPDSSQSLSAKEKLRSCSVFDAEKQQRHWGNGNNAISVETTAYALLQTLLLEDMEYAMPI
ATWLTERKNYGGGFCSTQDTVVALEAMSAYSIKTLSTVPTNLTVTLGAPGRRGDYTITLT
DTNEGIQKKLEFELGRKLEVSVQGRGNGTMSILKMYWSPELKNNPCNDLILTVEVEDIVY
SEENYDDEDYLTLVSSDSETLSRIDWFDIRSRRKRDVISPSKTESLQYKICVSRKSSPSR
YEQMSLVDLSLLSGLEPDTNDLEQLVTSSDQYIQHFEYKEGKVLLYFGELTSGPEPDCIV
FGAKQINPMGLVQPANAILYDFYSPDRKCSVFYSAPQHSAMLAKVCHAEVCQCAEGPCPR
EKSTFSKNLKENTRFNFVCYQPIADYVYEVELLNSTQKNVFDYYEVKIQRILKFTTDESI
QVGAHRHFLKRSSCTLNMVAGKRYLLMGKDGQTVDCNNKMQYFLDSQAWVEKIPEDRECH
TTRNRQACALLQSFLSKSDNICLF
Download sequence
Identical sequences G1NQ84
ENSMGAP00000015953 ENSMGAP00000015953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]