SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016063 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000016063
Domain Number - Region: 10-70
Classification Level Classification E-value
Superfamily E set domains 0.00249
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016063   Gene: ENSMGAG00000015147   Transcript: ENSMGAT00000017034
Sequence length 446
Comment pep:known_by_projection chromosome:UMD2:1:187859253:187867194:1 gene:ENSMGAG00000015147 transcript:ENSMGAT00000017034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFLLSGRTQFKVVIKALSPKEITRIYTPHPLDRNDGTFLMRYRMYGSVRKGLKIEILYGD
KHVAQSPYILKGPVYHEYCDCPEEDPEIWQNVFSCPSQEPQITKDFIPFPTIDLQRMFKE
IPSKFSQTRGAIVHYTILNNRIYRRSLGKYTDFKMFSDEMLLSLARKVHLPNVEFYLNVG
DWPVEYRKANDTPGPIPIISWCGSVDSRDIILPTYDITHSTLETLRGVTNDLLSIQGNTG
PFWDNKTEQALFRGRDSREERLYLVKLSKENPELLDAGITGYFFFREKEKELGKVPLMGF
FDFFKYKYQVNVDGTVAAYRFPYLLLGDSLVLKQDSQYYEHFYTVLKPWKHYVPVKRSLE
DLLEKIKWAKENDEEAQKIAKEGQSMARELLQPHRLYCYYYKVLQKYAERQASEPEIRDG
MELVPQRDDRDSVCSCHRKKPLREDL
Download sequence
Identical sequences G1NQH2
ENSMGAP00000016063 ENSMGAP00000016063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]