SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016146 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016146
Domain Number 1 Region: 115-359
Classification Level Classification E-value
Superfamily PA domain 6.02e-80
Family PA domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 61-108,341-484
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.26e-54
Family FolH catalytic domain-like 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016146   Gene: ENSMGAG00000015216   Transcript: ENSMGAT00000017118
Sequence length 484
Comment pep:novel chromosome:UMD2:1:195564318:195582163:1 gene:ENSMGAG00000015216 transcript:ENSMGAT00000017118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSASHRAARMARSRATLCTWLGCLALLGCFVLGFLIGWFKKPTEKNPNSSDVCQNVRQK
LVDEMKAESIKRFLRSFTELPHLAGTEQNFLLAKQIQGQWKEFGLDSAELVHYDVLLSYP
SETQPNYISVIDDQGNEIFNTSSFEPPPQGYENVTDILPPYNAFSAQGTPEADLVYVNYG
RTEDFFKLEREMGINCTGKIVIARYGKIFRGNKVKNAILAGAIGIILYSDPADYCAPGVD
PYPDGWNLPGRGVQRGNVLNLNGAGDPLTPGYPAKEYTFRYKVNEGVGIPKIPVHPIGYH
DAEVLLHAMGGPAAPDSTWKGALNVSYNVGPGFVDNFSTRKVRMHVHTSNKVARIYNVIG
IIRGAVEPDRYIILGGHRDSWVFGGIDPSTGAAVLQEVVRSFGKMKMEAISSWRPKRTII
FASWDAEEFGLLGSTEWAEENARVLQERAVAYINTDSSIEGNYTLRVDCTPLLYKLIYNL
TKEV
Download sequence
Identical sequences G1NQP2
ENSMGAP00000016146 ENSMGAP00000016146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]