SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016148 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016148
Domain Number 1 Region: 83-327
Classification Level Classification E-value
Superfamily PA domain 1.12e-80
Family PA domain 0.0000000079
Further Details:      
 
Domain Number 2 Region: 29-76,309-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.07e-28
Family FolH catalytic domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016148   Gene: ENSMGAG00000015218   Transcript: ENSMGAT00000017120
Sequence length 377
Comment pep:novel chromosome:UMD2:1:195740721:195753891:-1 gene:ENSMGAG00000015218 transcript:ENSMGAT00000017120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILMCCIGWFAKPVEEMIPLRPHLEMKAAFMAEMKAENIKHFLFNFTQRPHLAGTKENLHL
AQQVQAEWKEFGLDSVQLVHYDVLLSYPDENKPNYISIIDEHGNEVFNTSLSEPPPAGYE
AVGDVVPPYSAFSAQGMPEGELVYVNYGRTEDFFKLEREMGINCTGKIVIARYGKIFRGN
KVKNAELAGAKGIILYSDPADYWAPGVDPYPNGWNLPGGGAQRGNVLNLNGAGDPLTPGY
PAKEYTYRLDKASGVGLPKIPVHPIGYHDAESLLRNMGGSAPPHSSWKGNLNVSYNVGPG
FTTNYSTRKIKMHIHSNNKITRIYNVIGTIRGAVEPDRYVILGGHRDSWVFGGIDPQSGA
AVVHEIVRSFGTLKKEG
Download sequence
Identical sequences G1NQP4
ENSMGAP00000016148 ENSMGAP00000016148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]