SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016197 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016197
Domain Number 1 Region: 41-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-282
Family Motor proteins 0.0000000000868
Further Details:      
 
Domain Number 2 Region: 1956-2072
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-24
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 2073-2163
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-21
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 4 Region: 1252-1355
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-20
Family First domain of FERM 0.032
Further Details:      
 
Domain Number 5 Region: 1347-1441
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-16
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 6 Region: 1856-1964
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000131
Family First domain of FERM 0.08
Further Details:      
 
Domain Number 7 Region: 1573-1638
Classification Level Classification E-value
Superfamily SH3-domain 0.000000408
Family SH3-domain 0.004
Further Details:      
 
Domain Number 8 Region: 794-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000112
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016197   Gene: ENSMGAG00000015262   Transcript: ENSMGAT00000017169
Sequence length 2177
Comment pep:known_by_projection chromosome:UMD2:1:201270534:201329478:-1 gene:ENSMGAG00000015262 transcript:ENSMGAT00000017169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLCLQGDYVWMDLKTGREFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNASHIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYSPEQIR
LYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAQDERNYHVFYCMLRGMTMEQKKKLGLGKATDYNYLAMGNCTTCDGRDDSKEYAN
IRSAMKVLMFTDTENWEISKLLAAILHMGNLKYEARTYDNLDACEVVQSASLITAASLLE
VEPQDVMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIYR
PPSQELKSVRRSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLE
NINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLHKLNSQHKLNTNYIP
PKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSG
MMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCQRIAEAVLGKDDDWQ
IGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKVRNSVLMIQRYWRG
HNCRKNYGAMRIGFLRLQALYRSRKLHKQYHMARRRIIEFQARCRGYLVRRAFRHRLWAV
LTVQAYARGMIARRLYRRLRGEYHRRLEAEKLRLAEEERLRKEMSAKKAKEEAEKKHQVR
LAQLAREDAEREVKEKEEARRKKELLEKMERARNEPVNDSEMVDKMFGFLGTTSSLPGQE
GQAPNGFEDLERAQKELEEEDLDAALPLPEEEEEDLSEYKFAKFAATYFQGTTTHTYIRR
PLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGGEKIPVMTKIYETLGK
KTYKKELQALQGEGESTHIDGHKKNSVRHKLVSLTLKKKSKLTEEVTKRLHDGESTLQGN
SMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLTQNPSKSSHARGWILMSLCVG
CFAPSEKFVKYLRNFINGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIML
PVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGNDHVM
DAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPSEDNVATNLIYQQIVRGVKFGEY
RCDKEEDLAELASQQYYVDYGSEMVLERLLNLIPSYIPDREITASKTVEKWAQLIIAAHK
KGIYTQKRTDPRKVKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYF
VDEQEQVLLELSFPEITAVSSSRGGKLQGQSFTLATIKADEYTFTSNNAEDIRDLVVTFL
EGLRKRSKYVVTLQDNPNPVGEESGFLSFLKGDLIVLDQDTGEHVMNSGWANGFNERTKQ
KGDFPTDSVYVLPTVTMPPLEIVALVTMTPDQRQDVIRTSQMAISDSEERVKPYTLEEFS
YDYFRPPPKHTLSRVMITKSRGKDKLWCYTREPIKQPLLKKILGSEELSQEACMAFIAVL
KYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQTLKQLTDNHIKYSEEKGWELLW
LCTGLFPPSNILLPHVQRFLQSRKHHPLASDCIQRLQKALRNGSRKYPPHLVEVEAIQHK
TTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNISNRLLLKSSEGFSLFVKISDKVISVPE
GDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTNTTPGKDSMADSIFHYYQE
LPKYLRGYHKCTREEVLQLAALIYRVKFEDDKSYFPSIPKLLKELVPQDLVRQLSPDDWK
RSIVAYYNKHAGKTREEAKLAFLKIIFKWPTFGSAFFEVKQTTEPNYPEILLIAINKHGV
SLIDPKTKDILITHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYI
SQMLTAMSKQRSAKGSK
Download sequence
Identical sequences G1NQT3
ENSMGAP00000016197 ENSMGAP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]