SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016483 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016483
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 5.13e-80
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000887
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-23
Family Voltage-gated potassium channels 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016483   Gene: ENSMGAG00000015541   Transcript: ENSMGAT00000017457
Sequence length 429
Comment pep:novel chromosome:UMD2:16:4719000:4720289:-1 gene:ENSMGAG00000015541 transcript:ENSMGAT00000017457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGRVNPYSIVSSEEDGLRLTTMPGINGFGNGKIHTRRKCRNRFVKKNGQCNVEFTNMD
DKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTF
KPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSTNSFCYENELAFMSRDEDEEDDDSRGLDDLSPDNRHEFDRLQATIALDQ
RSYRRESEI
Download sequence
Identical sequences A0A226NIR2 A0A226PTH5 F1NHE9 G1NR98 R0LKG5 R9PXL9
ENSAPLP00000001557 XP_003210652.1.16129 XP_004945226.1.86415 XP_004945227.1.86415 XP_012953779.1.99704 XP_012953780.1.99704 XP_012953781.1.99704 XP_013030355.1.65836 XP_013030357.1.65836 XP_013030358.1.65836 XP_015149865.1.86415 XP_015732461.1.68032 XP_015732462.1.68032 XP_015732463.1.68032 XP_021267639.1.32913 ENSGALP00000007506 9031.ENSGALP00000007506 ENSMGAP00000016483 ENSMGAP00000016483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]