SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017108 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017108
Domain Number 1 Region: 156-339
Classification Level Classification E-value
Superfamily E set domains 4.67e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000173
Further Details:      
 
Domain Number 2 Region: 50-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-18
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017108   Gene: ENSMGAG00000016167   Transcript: ENSMGAT00000018082
Sequence length 376
Comment pep:known_by_projection chromosome:UMD2:1:113249716:113250846:1 gene:ENSMGAG00000016167 transcript:ENSMGAT00000018082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMEATQINMSRVPLVNGGISTVLKAHKPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVI
DMKWRYKLTLFAATFVMTWFLFGVIYYAIAFLHGDLEINKFTSKREPCVKNVDSLTGAFL
FSLESQTTIGYGFRFITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIK
FSHCAVITKHNGELCLVIRVANMRKSLLIQCQLSGKLLQTYETKEGERILLNQASVKFNV
DSSSESPFLILPLTFYHILDESSPLRDLTPQNLKDKDFELVVLLNATVESTSAVCQSRTS
YIPDEIHWGYEFVPVVSLSPNGKYVADFSQFEKIRRSTDSSFYSMDSEKQKLEEKYRQED
QRERELRTMLLQQSNV
Download sequence
Identical sequences G1NS88
ENSMGAP00000017108 ENSMGAP00000017108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]